KEGG   Streptobacillus moniliformis: Smon_0562Help
Entry
Smon_0562         CDS       T01125                                 

Definition
Alcohol dehydrogenase zinc-binding domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
smf  Streptobacillus moniliformis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smf00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Smon_0562
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smon_0562
  Lipid metabolism
   00071 Fatty acid degradation
    Smon_0562
  Amino acid metabolism
   00350 Tyrosine metabolism
    Smon_0562
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Smon_0562
   00626 Naphthalene degradation
    Smon_0562
Enzymes [BR:smf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Smon_0562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
634859..635902
Genome map
AA seq 347 aa AA seqDB search
MKAVVVNKESTGVEIVEKTLRPLKAGEALVDVEYCGVCHTDLHVAHGDFGKVSGRVLGHE
GIGIVREVAEGVTSLVPGDRVSIAWFFEGCGRCEYCVTGNETLCQSVKNAGYSADGGMAE
ECIVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKVGKPQPGQWVVIWGAGGLGNLAVQ
YAKKVFNTRVIAVDINDDKLALAKEVGADYVINGLKEDPVKKIMELSGIGAHISVVTAVS
KVAFNQAIDSARPAGRVVAVGLPSETMDVSIVATVLKGIEIIGSLVGTREDLKEAFDFGA
MGLVVPVVQTRPIEDAIDIFDEMEKGTIQGRMVIDFRKHDCGCGCKH
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagtagtagttaataaagaatcaactggtgtagaaattgttgaaaaaacatta
agaccattaaaagctggtgaagctttagtagatgttgaatattgtggagtttgtcataca
gatttacacgttgcacatggagattttggtaaagtatctggaagagtattaggacatgaa
ggaataggaatagtaagagaagttgctgaaggagttacttcattagttccaggagataga
gtttctattgcatggttctttgaaggatgtggaagatgtgaatattgtgttacaggaaat
gaaacattatgtcaatctgttaaaaatgcaggatattcagcagatggtggaatggctgaa
gaatgtatagttactgctgattatgcagttaaagttccagaaggattagatccagctcaa
gcaagttcaattacatgtgcaggagttactacatataaggcgattaaagtaggaaaacct
caacctggacaatgggtagtaatttggggagcaggaggacttggaaacttagctgttcaa
tatgcaaagaaagtatttaatactcgtgtaattgctgtagatattaatgatgataaatta
gctttagctaaagaagttggtgctgattatgtaattaatggattaaaagaagatccagtt
aagaaaattatggaattatcaggaattggagcacatatatcagttgttactgctgtatct
aaagttgctttcaaccaagcaatagattctgcaagaccagcaggaagagtagttgcagta
ggattaccttctgaaactatggatgtttcaattgttgcaacagtattaaaaggaatagaa
attattggttcattagttggaacaagagaagatcttaaagaagcatttgatttcggagct
atgggattagtagtaccagtagttcaaactagaccaattgaagatgcaatagatatattt
gatgaaatggaaaaaggaactattcaaggacgtatggttatcgatttcagaaaacatgat
tgtggttgtggatgtaaacattaa

DBGET integrated database retrieval system