KEGG   Streptobacillus moniliformis: Smon_0562Help
Entry
Smon_0562         CDS       T01125                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
smf  Streptobacillus moniliformis
Pathway
smf00010  Glycolysis / Gluconeogenesis
smf00071  Fatty acid degradation
smf00350  Tyrosine metabolism
smf00625  Chloroalkane and chloroalkene degradation
smf00626  Naphthalene degradation
smf01100  Metabolic pathways
smf01110  Biosynthesis of secondary metabolites
smf01120  Microbial metabolism in diverse environments
smf01130  Biosynthesis of antibiotics
smf01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smon_0562
  Lipid metabolism
   00071 Fatty acid degradation
    Smon_0562
  Amino acid metabolism
   00350 Tyrosine metabolism
    Smon_0562
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Smon_0562
   00626 Naphthalene degradation
    Smon_0562
Enzymes [BR:smf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Smon_0562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 TrkA_N DUF4823 Methyltransf_25 2-Hacid_dh_C Staph_haemo
Motif
Other DBs
NCBI-ProteinID: ACZ01041
UniProt: D1AXL5
Position
634859..635902
Genome map
AA seq 347 aa AA seqDB search
MKAVVVNKESTGVEIVEKTLRPLKAGEALVDVEYCGVCHTDLHVAHGDFGKVSGRVLGHE
GIGIVREVAEGVTSLVPGDRVSIAWFFEGCGRCEYCVTGNETLCQSVKNAGYSADGGMAE
ECIVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKVGKPQPGQWVVIWGAGGLGNLAVQ
YAKKVFNTRVIAVDINDDKLALAKEVGADYVINGLKEDPVKKIMELSGIGAHISVVTAVS
KVAFNQAIDSARPAGRVVAVGLPSETMDVSIVATVLKGIEIIGSLVGTREDLKEAFDFGA
MGLVVPVVQTRPIEDAIDIFDEMEKGTIQGRMVIDFRKHDCGCGCKH
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagtagtagttaataaagaatcaactggtgtagaaattgttgaaaaaacatta
agaccattaaaagctggtgaagctttagtagatgttgaatattgtggagtttgtcataca
gatttacacgttgcacatggagattttggtaaagtatctggaagagtattaggacatgaa
ggaataggaatagtaagagaagttgctgaaggagttacttcattagttccaggagataga
gtttctattgcatggttctttgaaggatgtggaagatgtgaatattgtgttacaggaaat
gaaacattatgtcaatctgttaaaaatgcaggatattcagcagatggtggaatggctgaa
gaatgtatagttactgctgattatgcagttaaagttccagaaggattagatccagctcaa
gcaagttcaattacatgtgcaggagttactacatataaggcgattaaagtaggaaaacct
caacctggacaatgggtagtaatttggggagcaggaggacttggaaacttagctgttcaa
tatgcaaagaaagtatttaatactcgtgtaattgctgtagatattaatgatgataaatta
gctttagctaaagaagttggtgctgattatgtaattaatggattaaaagaagatccagtt
aagaaaattatggaattatcaggaattggagcacatatatcagttgttactgctgtatct
aaagttgctttcaaccaagcaatagattctgcaagaccagcaggaagagtagttgcagta
ggattaccttctgaaactatggatgtttcaattgttgcaacagtattaaaaggaatagaa
attattggttcattagttggaacaagagaagatcttaaagaagcatttgatttcggagct
atgggattagtagtaccagtagttcaaactagaccaattgaagatgcaatagatatattt
gatgaaatggaaaaaggaactattcaaggacgtatggttatcgatttcagaaaacatgat
tgtggttgtggatgtaaacattaa

DBGET integrated database retrieval system