KEGG   Streptobacillus moniliformis: Smon_0671Help
Entry
Smon_0671         CDS       T01125                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
smf  Streptobacillus moniliformis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:smf00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Smon_0671
Enzymes [BR:smf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Smon_0671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
758855..759778
Genome map
AA seq 307 aa AA seqDB search
MNSKLYVLGSINVDLSIECDRFPKIGETIKGKGFEKNLGGKGSNQAIASSILGLDTYLIG
AVGSRDNNDWIYDELCNYGVNTSLVSKIEDEETGLAFIIRAKGDNSIILHSGANLKIKKE
NLINGLDKAKKGDYFLAQFEVDQDLVYFGIETASKKGMTVIINPSPAMKIDNKMYSLIDY
LIVNQTEAEILSNIYPETLEDCKRIFEILNKYELKNLVVTLGNKGSVLIDENNSVFSKGI
KIKPIDSTGAGDAFTGMFIRSLSMDISIKEKLYYSNISGALTCLQKGARIGVKNLNEIIN
FKEDINE
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtaagctttatgtattaggaagtataaatgtagacttatctattgaatgtgat
aggtttcctaaaataggagaaactattaaaggtaaaggttttgaaaaaaatctaggtggg
aaaggaagtaatcaagctatagcttcatctattttaggtttagatacttatttaattggt
gctgttggtagtagagataataatgattggatttatgatgagttatgtaattatggtgtc
aatacatctttagttagtaaaatagaagatgaggaaactggattagcatttattataagg
gctaagggagataattcaattattttacattctggtgcaaatttaaaaataaagaaagaa
aatctaataaatggattagataaagcaaaaaaaggtgattattttcttgcacaatttgaa
gtagatcaagatttagtttattttggaatagaaactgcttcaaaaaaaggtatgacagta
ataattaatccatcacctgctatgaagatagataataaaatgtattctttaattgattat
ttaatagttaatcaaacagaagcagaaattttatctaatatttatcctgaaactttagaa
gattgtaaaagaatttttgaaattttaaataaatatgaattaaaaaatttagttgttaca
cttggaaataaaggaagtgttttaattgatgaaaataatagtgttttttcaaaaggtatt
aaaattaaaccaatagatagtacaggggcaggagatgcctttacaggaatgtttattaga
agtttatctatggatatatctattaaagaaaaattatattattcaaacatttcaggagca
ttaacttgtttacaaaaaggtgctagaattggagttaaaaatttaaatgagattataaat
tttaaggaggatataaatgaataa

DBGET integrated database retrieval system