KEGG   Streptobacillus moniliformis: Smon_0734Help
Entry
Smon_0734         CDS       T01125                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
smf  Streptobacillus moniliformis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Smon_0734
   00052 Galactose metabolism
    Smon_0734
   00500 Starch and sucrose metabolism
    Smon_0734
   00520 Amino sugar and nucleotide sugar metabolism
    Smon_0734
Enzymes [BR:smf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Smon_0734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(824164..825057)
Genome map
AA seq 297 aa AA seqDB search
MKIRKAIIPAAGLGTRVLPATKAQPKEMLSIVDKPALQYLVEELIESGIQEILIITGRNK
QAIENHFDYSYELEAILKEKGKEELFNEVQNISKMINMYYVRQKLPLGLGHAISCAESFV
ADEPFLILLGDDIIYTDKEKGEIPVSKQLIDAYEKNGCGSFIGVQKVPRRDLNKYGIIKQ
SKKIDDKIYEIEDFVEKPNIEDAPSEFAALGRYILEPQIFKYLKEEKTIDYEIQLTPAIL
KMAKDNVSKLYSYEFDGLRYDTGDKFGMFKANVEFGLRHPELKEKIKEYLKELKVEL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcgtaaagcaattatacctgctgctggtcttggtactagagttttacctgct
actaaagcacaacctaaagaaatgttaagtattgttgataaaccagcattacagtattta
gtagaggaacttatagaaagtgggatacaagaaattttaataattactggaagaaataaa
caagctatagaaaatcattttgattattcttatgagttagaagctatattgaaagaaaaa
ggtaaagaagaattgtttaatgaagtacaaaatatttctaaaatgattaatatgtactat
gtaagacaaaaattacctttaggacttgggcatgcaatatcatgtgcagaatcttttgtt
gcagatgaacctttcttaattttattaggggatgacataatatatacagataaggaaaaa
ggagaaatacctgtatctaaacaacttatagatgcatatgaaaaaaatggttgtggaagt
ttcataggtgttcaaaaagtacctagaagagatttaaacaaatatggaatcattaagcaa
agtaagaaaatagatgataaaatatatgaaatagaagattttgttgaaaaaccaaatatt
gaagatgcaccaagtgaatttgctgcattaggtagatatattttagaacctcaaatattt
aaatatttaaaagaagaaaaaactattgattatgaaattcaattaacacctgcaatatta
aaaatggcaaaagataatgtatctaaactttattcatatgaatttgatggattaagatac
gatacaggagataaatttggtatgtttaaggctaatgttgaatttggattaagacatcct
gaattaaaagaaaaaataaaagagtatttaaaagagttaaaggtagaattatga

DBGET integrated database retrieval system