KEGG   Streptobacillus moniliformis: Smon_0799Help
Entry
Smon_0799         CDS       T01125                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
smf  Streptobacillus moniliformis
Pathway
smf00010  Glycolysis / Gluconeogenesis
smf00052  Galactose metabolism
smf00500  Starch and sucrose metabolism
smf00520  Amino sugar and nucleotide sugar metabolism
smf01100  Metabolic pathways
smf01110  Biosynthesis of secondary metabolites
smf01120  Microbial metabolism in diverse environments
smf01130  Biosynthesis of antibiotics
smf01200  Carbon metabolism
Module
smf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:smf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smon_0799
   00052 Galactose metabolism
    Smon_0799
   00500 Starch and sucrose metabolism
    Smon_0799
   00520 Amino sugar and nucleotide sugar metabolism
    Smon_0799
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Smon_0799
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Smon_0799
Enzymes [BR:smf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Smon_0799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase FGGY_N
Motif
Other DBs
NCBI-ProteinID: ACZ01268
UniProt: D1AY92
Position
complement(891731..892684)
Genome map
AA seq 317 aa AA seqDB search
MKYYGGIDLGGTNSKIGILDENGNIIYSTIVKTESNLGYKETIKKLSDCLKVGLDENKIN
YDDFISLGMGVPGPTVNKSTVIMWANFPWPENLNLANEFENQLSKPVYIDNDVNIITLGE
LWVGAAKGYKNVLGMAIGTGIGGAVVVNGEIISGKNGASGEIGHIPLEKKGRLCGCGKRG
CFEAYASATGIERIAKDRLEVNKNNMLYNLTKDRDIEAKDVFECAKQGDKLSMDIVEETA
EYLAMGIGTALSILDSDIVVMGGGVALAGEFLTDKIKKYLPDYLMTSIEKNVEIKIAELG
NNAGIYGAAYLAMQSKK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattatggtggaattgatttaggagggactaattcaaaaataggtattttagat
gaaaatggaaatattatttattcaacaatagttaaaactgaatctaatttaggatacaaa
gaaacaattaaaaaattatcggactgtttaaaggttggattagatgaaaataagataaat
tatgatgatttcatttctttagggatgggagttccaggacctactgtaaataaatcaaca
gtaataatgtgggcaaattttccatggcctgaaaatttgaatctagcaaatgaatttgaa
aatcaattatcaaaaccagtatatatagataatgatgttaatattattacacttggggaa
ttatgggttggtgctgcaaaaggatataaaaatgtactaggaatggcaataggaactgga
ataggtggagcagtagtagtaaatggtgaaattatttcaggtaaaaacggtgcttctgga
gaaatcggacatatacctttagagaaaaaaggaagattatgtggttgtggtaaaagaggg
tgttttgaagcctatgcatcagcaactggtattgaaagaatagctaaggatagattagaa
gttaataaaaataatatgctatataacttaacaaaagatagagatatagaagcaaaagat
gtgtttgaatgtgcaaaacaaggagataaattatcaatggatatagttgaagaaacagcg
gaatatcttgctatgggaataggtacagctctatctatacttgattctgacatagtagtt
atgggtggtggagttgcacttgctggagaatttttaacagataaaataaagaaatatttg
cctgattatttgatgacatctattgaaaaaaatgttgaaataaaaattgctgaacttggt
aataatgcaggaatttatggagctgcatatctagctatgcagtcaaaaaaatag

DBGET integrated database retrieval system