KEGG   Streptobacillus moniliformis: Smon_0799Help
Entry
Smon_0799         CDS       T01125                                 

Definition
ROK family glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
smf  Streptobacillus moniliformis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:smf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Smon_0799
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smon_0799
   00052 Galactose metabolism
    Smon_0799
   00500 Starch and sucrose metabolism
    Smon_0799
   00520 Amino sugar and nucleotide sugar metabolism
    Smon_0799
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Smon_0799
   00524 Butirosin and neomycin biosynthesis
    Smon_0799
Enzymes [BR:smf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Smon_0799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(891731..892684)
Genome map
AA seq 317 aa AA seqDB search
MKYYGGIDLGGTNSKIGILDENGNIIYSTIVKTESNLGYKETIKKLSDCLKVGLDENKIN
YDDFISLGMGVPGPTVNKSTVIMWANFPWPENLNLANEFENQLSKPVYIDNDVNIITLGE
LWVGAAKGYKNVLGMAIGTGIGGAVVVNGEIISGKNGASGEIGHIPLEKKGRLCGCGKRG
CFEAYASATGIERIAKDRLEVNKNNMLYNLTKDRDIEAKDVFECAKQGDKLSMDIVEETA
EYLAMGIGTALSILDSDIVVMGGGVALAGEFLTDKIKKYLPDYLMTSIEKNVEIKIAELG
NNAGIYGAAYLAMQSKK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattatggtggaattgatttaggagggactaattcaaaaataggtattttagat
gaaaatggaaatattatttattcaacaatagttaaaactgaatctaatttaggatacaaa
gaaacaattaaaaaattatcggactgtttaaaggttggattagatgaaaataagataaat
tatgatgatttcatttctttagggatgggagttccaggacctactgtaaataaatcaaca
gtaataatgtgggcaaattttccatggcctgaaaatttgaatctagcaaatgaatttgaa
aatcaattatcaaaaccagtatatatagataatgatgttaatattattacacttggggaa
ttatgggttggtgctgcaaaaggatataaaaatgtactaggaatggcaataggaactgga
ataggtggagcagtagtagtaaatggtgaaattatttcaggtaaaaacggtgcttctgga
gaaatcggacatatacctttagagaaaaaaggaagattatgtggttgtggtaaaagaggg
tgttttgaagcctatgcatcagcaactggtattgaaagaatagctaaggatagattagaa
gttaataaaaataatatgctatataacttaacaaaagatagagatatagaagcaaaagat
gtgtttgaatgtgcaaaacaaggagataaattatcaatggatatagttgaagaaacagcg
gaatatcttgctatgggaataggtacagctctatctatacttgattctgacatagtagtt
atgggtggtggagttgcacttgctggagaatttttaacagataaaataaagaaatatttg
cctgattatttgatgacatctattgaaaaaaatgttgaaataaaaattgctgaacttggt
aataatgcaggaatttatggagctgcatatctagctatgcagtcaaaaaaatag

DBGET integrated database retrieval system