KEGG   Streptobacillus moniliformis: Smon_0816Help
Entry
Smon_0816         CDS       T01125                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
smf  Streptobacillus moniliformis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:smf00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(909250..910716)
Genome map
AA seq 488 aa AA seqDB search
MRKAGILLHPTSLSGKEGIGTLGFEAYRFIDFLKKSKQKLWQIFPLGPTGYGDSPYQCFS
AFAGNPYLIDLETLVQEGYLDYSVLDTNFGDNKENIDYGMIYTNKLPILRSAFEKFNIEN
EDFIKFNIENDYWLDNYSLFAALKTYFNGESWSNWPNELKNRDNGAIKEYKVKLADEINY
QKFLQYIFLKQWKSVKSYANQNGIEIIGDIPIFVSMDSADAWSNPEIFLFDKDRNPVKVA
GVPPDYFSATGQLWGNPLFDWNKLKETGYKWWIDRVKANLSLYDIIRIDHFRGFESYWAV
NYGETTAINGKWEKGPGIDLFNAIKKSLGEINIIAEDLGILTDEVVELKESAGFPGMKIL
QFAFDKDPENEYLPHNYEKNTVVYTGTHDNDTTNSWYFKLNDMQKGEVRDYLNVSDDSYI
VYSMIRLALRSVAETAIIPMQDYLNLGEFARINTPGLASGNWQWRLNGWELNDDLASTIA
HITEIYGR
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagcagggattttacttcatcctacatctctttctggaaaagaaggaataggt
actttgggatttgaagcatatagatttattgattttttaaaaaaatctaaacaaaaacta
tggcaaatatttccattaggacctacaggttatggagattctccgtatcaatgtttttct
gcatttgcaggtaatccatatttaatagacttagaaactttagttcaagagggatattta
gattattcagtacttgatacgaattttggagataataaagaaaatattgattatggaatg
atttatacaaataaattacctatattaagaagtgcttttgagaagtttaatatagaaaat
gaggattttattaaatttaatatagaaaatgattattggttagataattattctctattt
gctgcattaaaaacatattttaatggagaatcatggtcaaattggccaaatgaattaaaa
aatagagataatggagcaataaaagaatataaagttaaattagctgatgaaattaactat
caaaaatttttacaatatatatttcttaaacaatggaaatctgttaaatcatatgctaat
caaaatgggattgaaattattggagatataccaatatttgtatctatggattcagcagat
gcgtggtcaaatccagaaatattcttatttgataaagatagaaatccagttaaggttgca
ggagttccacctgattatttctcagcaactgggcaattatgggggaatccattatttgat
tggaataaattaaaagaaacaggatataaatggtggatagatagagttaaagctaacctt
tctctatatgatataataagaatagatcattttagaggatttgaatcatattgggctgtt
aattatggagaaactacagctattaatggtaaatgggaaaaaggaccaggaattgattta
tttaatgctataaaaaaatctttaggagagattaatattattgcagaagatttaggtata
cttacagatgaagttgtagaattaaaagaaagtgcaggatttccaggaatgaaaatttta
caatttgcatttgataaagatcctgaaaatgaatatttaccacataattatgaaaaaaat
actgtagtttatacaggaacacatgataatgatacaacaaattcatggtattttaaactt
aatgatatgcaaaaaggagaggtaagagattacttaaatgtaagtgatgattcatatata
gtttattcaatgattagacttgctttaagatctgttgctgaaactgcaataataccaatg
caagattatttaaatttaggagaatttgcacgtattaatactccaggacttgcaagtgga
aactggcaatggagattaaatggttgggaattaaacgatgatttagcatcaacaattgca
cacataactgaaatatatggtagataa

DBGET integrated database retrieval system