KEGG   Streptobacillus moniliformis: Smon_1052Help
Entry
Smon_1052         CDS       T01125                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
smf  Streptobacillus moniliformis
Pathway
smf00010  Glycolysis / Gluconeogenesis
smf00071  Fatty acid degradation
smf00350  Tyrosine metabolism
smf00620  Pyruvate metabolism
smf00625  Chloroalkane and chloroalkene degradation
smf00626  Naphthalene degradation
smf00650  Butanoate metabolism
smf01100  Metabolic pathways
smf01110  Biosynthesis of secondary metabolites
smf01120  Microbial metabolism in diverse environments
smf01130  Biosynthesis of antibiotics
smf01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smon_1052
   00620 Pyruvate metabolism
    Smon_1052
   00650 Butanoate metabolism
    Smon_1052
  Lipid metabolism
   00071 Fatty acid degradation
    Smon_1052
  Amino acid metabolism
   00350 Tyrosine metabolism
    Smon_1052
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Smon_1052
   00626 Naphthalene degradation
    Smon_1052
Enzymes [BR:smf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Smon_1052
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Smon_1052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 LuxC
Motif
Other DBs
NCBI-ProteinID: ACZ01515
UniProt: D1AUV5
Position
complement(1141042..1143660)
Genome map
AA seq 872 aa AA seqDB search
MVVKDIKSLKEMMKNVREAQEKYASFTQEQVDKIFRKVAQTINDQRIILATMAVEETGMG
LIEDKVIKNHFASEYIYNKYKDEKTCGILEEDKSYGIKKIATPIGVIAGVIPTTNPTSTA
IFKILLALKTRNAIIISPHPRAKNSTIYAAKLALEVAKKYGAPDNIISWIDEPSMELSRE
LMANVDLILATGGPGMVKSAYSSGTPAIGVGAGNTPVIIDESADVKMTANYILLSKTFDN
GVICASEQAVILPESRYDEIKKEFINRGAYVLKKDEIQKVRDVMFKEGALNADIVGQSAY
TIATMAGLKVPESIRVLIGEVKDYSGKEAFAHEKLSPILAMYKAKGFEEQMTIAKALIEL
GGLGHTSCMYINEAETEKINRFGREMKTGRTLINMPASLGAIGDVFNFKLEPSLTLGCGS
WGGNSVSENVGVKHLLNVKTVAERRENMLWFKVPEKIYFKYGSLPIAIEELKDENHKKAF
IVTDSTLAELGYTNHITKVLERIGIDYRIFSNVGVDPTLSCTISGAEAMREYKPDVIIAL
GGGSAMDAAKIMWVLYEYPNIRFKDLAMRFMDIRKRIFAFPKMGIKAKFVAVATSAGTGS
EVTPFSVITDDETGVKYPLADYELTPDVAINDPELMLTMPKGLTVASGIDVFTHAIESYV
SILATEYTKPYSLEAMKLVMKYLPESVALGSKAVKAKEKMANASCIAGMAFANAFLGINH
SLAHKLGGKFHVPHGIANALVLGEVIRFNAEEAPTKMGVFPQYRYPDAVNRYAKVADFLG
LSKEGQTKEEKVEALIEGIEELKEKIGIPKTIKDWGIPEKDFLEAVDELSVDAFDDQCTP
ANPRYPLISELKEIYLKSYYGREEYSKMKNFK
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atggtagttaaagacatcaaaagtttaaaagagatgatgaaaaatgttagagaagcacaa
gaaaaatatgcttcatttacacaagagcaagtagacaaaatttttagaaaagttgctcaa
acaattaatgatcaaagaattattcttgcaactatggctgttgaagaaacaggtatggga
ttaatagaggataaggttattaaaaatcactttgcatcagaatatatttataacaagtat
aaagatgaaaaaacttgtggtattttagaagaagataaatcttatggtattaaaaaaata
gccactcctataggtgtcattgcaggggttatacctacaacaaaccctacttctacagct
atatttaaaatattgcttgcattaaaaacaagaaatgcgattattatatctccacaccca
agagcaaaaaattcaactatatatgcagcaaaacttgcattagaagttgctaaaaaatat
ggtgctcctgataatatcatatcttggatagatgaaccaagtatggaattatcgagagaa
ttaatggcaaatgttgatttaatactcgctacaggaggacctggaatggttaagagtgct
tactcttcaggaacacctgctataggggttggagcaggaaatactccagtaattatagat
gaaagtgctgatgttaagatgacagcaaattatatcctattatctaaaacatttgataat
ggtgttatttgtgcatcagaacaagctgttatactacctgaatcaagatatgatgaaatt
aaaaaagaatttataaatagaggagcatatgttcttaaaaaagatgaaattcaaaaagtt
agagatgtaatgtttaaagaaggagctttaaatgcagatatagttggtcaaagtgcatac
actatagctactatggctggattaaaagtacctgaaagcattagagtattaataggggaa
gtaaaagattattctggaaaagaagcttttgctcatgaaaaattatctccaatcttagct
atgtataaggctaagggatttgaagaacaaatgactatagctaaggcattaattgaactt
ggtggacttggacatacttcttgtatgtatattaatgaagcagaaacagaaaaaatcaat
agatttggtagagaaatgaaaacaggaagaacccttataaacatgcctgcatcacttgga
gcaataggagatgtatttaactttaaattagaaccatcattaacacttggttgtggttca
tggggaggaaactctgtttcagaaaatgttggagttaagcatctattaaatgttaaaaca
gtagcagaaagaagggaaaacatgttatggttcaaagttccagaaaaaatctactttaaa
tatggttcattacctatagctatagaagaattaaaagatgaaaatcataaaaaagccttt
atagtaacagatagtactttagcagaattaggttatactaaccacattactaaagttctt
gaaagaataggtatagattacagaatattttctaatgttggagtagatcctacattaagt
tgtactatttcaggagcagaagctatgagagagtataagccagatgtaatcattgcactt
ggtggaggatctgctatggatgctgccaagattatgtgggtactatatgaatatcctaat
attagatttaaagatttagcaatgagatttatggatatacgtaagagaatatttgcattc
cctaaaatgggtattaaagctaaatttgtagctgttgcaacttcagcaggaactggttca
gaagttacaccattttcagtaattactgatgatgaaacaggagtaaaatatccattagct
gactatgaattaacaccagatgtagctattaatgatccagaattaatgttgactatgcct
aaaggattaactgtagcatcaggaatagatgtatttacgcatgctattgaatcatatgtt
tcaattttagcaacagaatatactaaaccttattcattagaagctatgaagttagttatg
aaatatctacctgaatcagtagctttaggttcaaaagcagttaaagctaaagaaaaaatg
gcaaatgcttcatgtatagcaggtatggcttttgctaatgccttcttaggaattaatcac
tcattagcacataaattaggtggaaaattccatgtaccacatggtatagcaaatgcttta
gtattaggtgaagttattagatttaatgctgaggaagcaccaactaagatgggagtattc
cctcaatatagatatccagatgcagtaaatcgttatgccaaagttgctgatttcttagga
ttatctaaagaaggtcaaactaaagaagaaaaagttgaagctttaattgaaggtatagaa
gaattaaaagaaaaaattggaataccaaaaactattaaagattggggaatacctgaaaaa
gatttcttagaagctgtagatgagttatcagttgatgcatttgatgatcaatgtactcct
gcaaatccaagatacccattaatttcagaattaaaagaaatatatctaaaatcttattac
ggtagagaagaatattcaaaaatgaaaaattttaaataa

DBGET integrated database retrieval system