KEGG   Streptobacillus moniliformis: Smon_1059Help
Entry
Smon_1059         CDS       T01125                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
smf  Streptobacillus moniliformis
Pathway
smf00010  Glycolysis / Gluconeogenesis
smf00260  Glycine, serine and threonine metabolism
smf00680  Methane metabolism
smf01100  Metabolic pathways
smf01110  Biosynthesis of secondary metabolites
smf01120  Microbial metabolism in diverse environments
smf01130  Biosynthesis of antibiotics
smf01200  Carbon metabolism
smf01230  Biosynthesis of amino acids
Module
smf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
smf_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:smf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smon_1059
  Energy metabolism
   00680 Methane metabolism
    Smon_1059
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Smon_1059
Enzymes [BR:smf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Smon_1059
Membrane trafficking [BR:smf04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Smon_1059
Exosome [BR:smf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Smon_1059
  Exosomal proteins of melanoma cells
   Smon_1059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACZ01522
UniProt: D1AUW2
Position
1152827..1153516
Genome map
AA seq 229 aa AA seqDB search
MKLVLVRHGESEWNLQNRFTGWIDVDLTEKGVQEAKNGGQALKELGYTFDVAFTSFQKRA
NKTLNYILEEIDQLYLPVYKSWRLNERHYGALQGLNKAETAKQYGEEQVHIWRRSFDVAP
PHVELTDEVNYPRFQERYKDIPESECPRGESLKDTIARVLPYWETNISKEIKAGKDVIVV
AHGNSLRSLIKYLLNIDDVKILDLNLPTGKPLVFEINENLEIVSAPELF
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagtattagtacgtcatggagaaagtgaatggaatttacaaaatagatttaca
ggttggatagatgtagatttaactgaaaaaggggttcaagaagctaaaaacggaggacaa
gctttaaaagaattaggatatacttttgatgttgctttcacttcttttcaaaaaagagct
aacaaaactcttaactatattttagaagaaatagatcaactatatttaccagtatataaa
tcttggagattaaatgaaagacattatggtgctttacaaggtttaaataaagcagaaact
gctaaacaatacggtgaagaacaagtacatatatggagaagaagttttgatgtagcacct
cctcatgttgaattaacagatgaagtaaactacccaagattccaagaaagatataaggat
atacctgaaagtgaatgcccaagaggggaaagcttaaaagatactatagcaagagtttta
ccatattgggaaacaaacatttcaaaagaaattaaagcaggtaaagatgtaatagttgtt
gcacacggaaacagcttaagatcattaatcaaatatttattaaacatagacgatgttaaa
atacttgatttaaacctacctactggaaaaccattagtatttgaaataaacgagaattta
gaaatagtttcagcacctgaattattctaa

DBGET integrated database retrieval system