KEGG   Streptobacillus moniliformis: Smon_1059Help
Entry
Smon_1059         CDS       T01125                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.4)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
smf  Streptobacillus moniliformis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:smf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Smon_1059
   01230 Biosynthesis of amino acids
    Smon_1059
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smon_1059
  Energy metabolism
   00680 Methane metabolism
    Smon_1059
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Smon_1059
Enzymes [BR:smf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Smon_1059
Exosome [BR:smf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Smon_1059
  Exosomal proteins of melanoma cells
   Smon_1059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1152827..1153516
Genome map
AA seq 229 aa AA seqDB search
MKLVLVRHGESEWNLQNRFTGWIDVDLTEKGVQEAKNGGQALKELGYTFDVAFTSFQKRA
NKTLNYILEEIDQLYLPVYKSWRLNERHYGALQGLNKAETAKQYGEEQVHIWRRSFDVAP
PHVELTDEVNYPRFQERYKDIPESECPRGESLKDTIARVLPYWETNISKEIKAGKDVIVV
AHGNSLRSLIKYLLNIDDVKILDLNLPTGKPLVFEINENLEIVSAPELF
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagtattagtacgtcatggagaaagtgaatggaatttacaaaatagatttaca
ggttggatagatgtagatttaactgaaaaaggggttcaagaagctaaaaacggaggacaa
gctttaaaagaattaggatatacttttgatgttgctttcacttcttttcaaaaaagagct
aacaaaactcttaactatattttagaagaaatagatcaactatatttaccagtatataaa
tcttggagattaaatgaaagacattatggtgctttacaaggtttaaataaagcagaaact
gctaaacaatacggtgaagaacaagtacatatatggagaagaagttttgatgtagcacct
cctcatgttgaattaacagatgaagtaaactacccaagattccaagaaagatataaggat
atacctgaaagtgaatgcccaagaggggaaagcttaaaagatactatagcaagagtttta
ccatattgggaaacaaacatttcaaaagaaattaaagcaggtaaagatgtaatagttgtt
gcacacggaaacagcttaagatcattaatcaaatatttattaaacatagacgatgttaaa
atacttgatttaaacctacctactggaaaaccattagtatttgaaataaacgagaattta
gaaatagtttcagcacctgaattattctaa

DBGET integrated database retrieval system