KEGG   Streptobacillus moniliformis: Smon_1311Help
Entry
Smon_1311         CDS       T01125                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
smf  Streptobacillus moniliformis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smf00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Smon_1311
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Smon_1311
Enzymes [BR:smf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Smon_1311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1433871..1435592)
Genome map
AA seq 573 aa AA seqDB search
MSKLVNLREKPYNLDDEQIKWVEDTLSSITDEEKIGQLFFNLFWLGDLATESKYSNEEII
TKFKVGGARYQGGNKYEVMNLLNNLQKNSKIPLLIAANCDSGGNGACSDGTYIATAAMCE
ASGDLEVSYNAGYVSGVEEEALGINVNFDPCVDVLKNWRNTIVNTRAYGRDVDIVIKHSN
AYLEGLDKSNVIKCIKHFPGDGTEERDQHLILGVNELTVEEWERSFGEVYRNHINNGVEM
IMAGHIALPHYQKLINPSLEDKDILPATLSKELIEDLLKDKLKFNGLVITDASHMLGMTA
SMRRKDYVPLAIASGCDMFLFFNDIDEDFKYMLDGYKKGIITEERLNDAVRRILGLKAKL
NLHIRQKENTLLKDEKGLDLIGCEKHIKMQKEAVDKGISLIKNTKFELPINPEKHKKVRL
YILEGEKNGIYRPNEKFQEYCIKKLEEKGFEVTVNESGKREKGSIEKYRSEVDLALVFAN
IKGYAEANNMRIKWSGPMSNEIPWYVHEVPTVMVSFNFTNHLHDATMVKCYINAYYDNEV
TIDTLIEKLMGKSEFKGKHFNENVWAGQWQAKL
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaattagttaatttaagggaaaaaccatacaatttagatgatgaacaaattaaa
tgggtagaagatactttatcaagtattacagatgaagaaaaaattggtcaactatttttt
aatctgttttggttaggtgatctagctacagaatcaaagtattcaaatgaagagatcatt
actaaatttaaagttggtggtgcaaggtatcaaggtggtaataaatatgaggtaatgaat
cttttaaataatctacaaaaaaattctaagatacccttacttattgctgcaaattgtgat
tcaggtggtaatggagcatgctcagatggtacatatatcgcaacagctgctatgtgtgaa
gcaagtggagatttagaagtttcatataatgcaggttatgtaagtggagttgaagaagag
gcattaggtattaatgttaattttgatccatgtgtagatgtattaaaaaattggagaaat
actatagtaaatacaagggcttatggtagagatgtagatattgttattaaacatagtaat
gcatatcttgaaggtcttgataagagtaatgttataaaatgtattaaacatttcccagga
gatggaacagaagaaagagatcaacatttaattttaggagtaaatgagttaactgtagaa
gaatgggaaagatcttttggagaagtttatagaaatcatattaataatggtgtagaaatg
ataatggcagggcatattgcacttccacattatcagaaattaataaatccaagtcttgaa
gataaggatattctgccagctacattatctaaggaattaatagaagatttattgaaagat
aaattaaaatttaatggtcttgtaattacagatgcttctcatatgttaggtatgacagct
agtatgagaagaaaagattatgtacctttagctatagcttcaggttgtgatatgttctta
ttctttaatgatatagatgaagattttaaatatatgttagatggttataaaaagggaata
ataacagaagaaagattaaatgatgcagttagaagaatattaggtttaaaagcaaagtta
aacttacatattagacaaaaagaaaatactttattaaaagatgaaaaaggattagattta
ataggttgtgaaaaacatattaaaatgcaaaaagaagcagtagataaaggtattagtttg
ataaagaatactaaatttgaattacctattaatcctgaaaaacataaaaaagttagacta
tatatacttgaaggagagaaaaatggtatatatagacccaatgaaaaatttcaagaatat
tgtattaagaagttagaagaaaaaggctttgaagtaactgtaaatgaatcaggaaaaaga
gaaaaggggtctatagaaaagtatagaagtgaagtagatttagcattagtttttgcaaat
attaaaggatatgctgaagcaaataatatgagaataaaatggagtggacctatgtctaat
gaaattccatggtatgtacatgaagtaccaacagtaatggtgtcttttaatttcactaat
catttacatgatgccactatggtgaaatgctatataaatgcatattatgataatgaagta
actatagatactttaatagaaaaattaatgggaaaatcagaatttaaaggaaaacatttt
aatgaaaatgtatgggctggtcaatggcaagctaagttataa

DBGET integrated database retrieval system