KEGG   Candidatus Sulcia muelleri GWSS: SMGWSS_081Help
Entry
SMGWSS_081        CDS       T00630                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
smg  Candidatus Sulcia muelleri GWSS
Pathway
smg00020  Citrate cycle (TCA cycle)
smg00640  Propanoate metabolism
smg00660  C5-Branched dibasic acid metabolism
smg01100  Metabolic pathways
smg01110  Biosynthesis of secondary metabolites
smg01120  Microbial metabolism in diverse environments
smg01130  Biosynthesis of antibiotics
smg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SMGWSS_081 (sucC)
   00640 Propanoate metabolism
    SMGWSS_081 (sucC)
   00660 C5-Branched dibasic acid metabolism
    SMGWSS_081 (sucC)
Enzymes [BR:smg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SMGWSS_081 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ABS30498
UniProt: A8Z5U7
Position
78159..79334
Genome map
AA seq 391 aa AA seqDB search
MNLHEYQAKKILATFGVKVPYSINALNIEETVYAAKKVFKKTKEYICVIKAQIHAGGRGK
GGGIKISKYIDDVYKKSSKILGRRLVTNQTNNKGKIVNKVLISEYVFNTEKENEYYISIF
YDRNIYQNRILYSKEGGLEIESKYRYKKIFLQKIDPYIGIQDFLIRKIAFNLKIKYSAFI
RFKTFIRNIYNAYIYSDASLLEINPVFITKNNEILAIDAKVILDDNALFRHMDYKEMYDE
KEYDLIELEAKKAGLNYLKLDGEVACMVNGAGLAMSTMDMIKLYGANPANFLDLGGKADS
KCIKKGFDIILKDKKVKIILINIFGGIVRCDIVAEGIINYFNKSINKKIILRLEGTNVNL
AKKLINNSNSIINNSIIYVTSLEEAANKIII
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacatgaatatcaagctaagaaaatattagcaacttttggggtaaaagttcct
tatagtattaatgctttaaatattgaagaaacggtatatgctgctaaaaaagtatttaaa
aaaacgaaagaatatatttgtgtaataaaagctcaaatacatgctgggggacgtggaaag
ggaggtggaataaaaatatctaaatatatagatgacgtatataaaaaatcatcaaagatc
cttggtaggagattagtaactaatcaaacaaataataaaggtaaaattgtaaataaagtt
cttatatcagaatatgtttttaatactgaaaaagagaacgaatattatatatctatattc
tatgatagaaatatatatcaaaatagaattctatattctaaagagggaggtttagaaata
gaatctaaatatagatataaaaagatatttttacaaaaaatagatccttatataggaata
caagattttttaattcgaaaaatagcatttaatttaaaaattaaatattcagcttttatt
aggtttaaaacatttataagaaatatatataatgcatatatatattctgatgcttctctt
ttggagataaatccagttttcataactaaaaataatgaaatattagcaatagatgctaaa
gtaatattagatgataatgctttgtttcgtcatatggattataaagaaatgtatgatgaa
aaagaatatgatctaatagaattagaagctaaaaaagcaggtttaaattatctaaagtta
gatggggaggtagcatgtatggtaaatggagcaggtttagcaatgtctactatggatatg
atcaaactatatggagctaatccagctaattttttagatttaggtggtaaagcagattca
aaatgtataaaaaaaggatttgatataatcttaaaagataaaaaagtaaaaataatatta
ataaatatttttggaggaattgttcgatgtgatatagttgctgaaggcattataaattat
tttaataaaagtataaataagaaaattattctaaggttagaaggtacaaatgtaaattta
gcaaaaaaactaataaataatagtaatagtataataaataatagtataatatatgtaact
tctcttgaagaagctgctaataaaattataatataa

DBGET integrated database retrieval system