KEGG   Candidatus Sulcia muelleri GWSS: SMGWSS_121Help
Entry
SMGWSS_121        CDS       T00630                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
smg  Candidatus Sulcia muelleri GWSS
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SMGWSS_121 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMGWSS_121 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SMGWSS_121 (trpA)
Enzymes [BR:smg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SMGWSS_121 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(117501..118256)
Genome map
AA seq 251 aa AA seqDB search
MNKIKRLFINKKKNILNIYFTAGYPSIDSMPLILKRLQNLNIDIVEIGIPYSDPLADGNI
IQKSNTKSLKNGMNISVLFYKLKKVKKYINIPIILMGYYNQFIKYGEIKFLEDCIESGVS
GLILPDLPPRIYLNKYKKIFKKSKLAFIVLITPQTSLKRLKRLSSITDYFLYIVSSNSTT
GTKNNINLSFLERIKEINVPKLIGFGICDKKSLNIAFKYAEGAIIGSAFIKAIKKSYLEK
SIEKFIKYIIK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaataaaaagattatttataaataaaaaaaaaaatatattaaatatatatttc
actgctggctatccatctatagatagtatgccacttatattaaaaagattacagaatcta
aatatagatatagtagaaattggaataccatattctgatccattagcagatggaaatata
atacaaaaaagtaatacaaaatctttaaaaaatggtatgaatatatccgttttattttat
aaacttaaaaaagtaaaaaaatatataaatattccaataattttaatgggatattataat
caatttataaaatatggcgaaataaaatttttagaagattgtatagaatctggtgtatct
ggattaattttaccagacttacctccaaggatttacctaaataaatataaaaaaatattt
aaaaaatctaaattagcatttatagttttaattactcctcaaacatctttaaaacgtctt
aaaaggttaagtagtattactgattattttttatatatagtttcatctaattctactaca
ggtactaaaaataatataaatttatcatttctagaaagaataaaagaaataaatgttcct
aaacttattggttttggaatatgtgataaaaaatcattaaatatagcatttaaatatgct
gaaggagcaattattggaagtgcttttataaaagctattaaaaagtcttatttagaaaaa
agtatagaaaaatttataaaatatattataaaatag

DBGET integrated database retrieval system