KEGG   Candidatus Sulcia muelleri GWSS: SMGWSS_122Help
Entry
SMGWSS_122        CDS       T00630                                 

Definition
(GenBank) putative tryptophan synthase, beta subunit (trpB)/anthranilate isomerase activity of trpC (trpF)
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
K01817  phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
smg  Candidatus Sulcia muelleri GWSS
Pathway
smg00260  Glycine, serine and threonine metabolism
smg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
smg01100  Metabolic pathways
smg01110  Biosynthesis of secondary metabolites
smg01130  Biosynthesis of antibiotics
smg01230  Biosynthesis of amino acids
Module
smg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMGWSS_122
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SMGWSS_122
Enzymes [BR:smg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SMGWSS_122
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     SMGWSS_122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PRAI
Motif
Other DBs
NCBI-ProteinID: ABS30534
UniProt: A8Z5Y3
Position
complement(118249..120036)
Genome map
AA seq 595 aa AA seqDB search
MFKKRKIKICGLKYYNNISSIIDLYPDFIGFIFFEKSPRFVGDNFLAPDTIGISKVGVFV
NEKEDKLLKLSIKNNLDFVQLHGDESPYYCRNIYKKGIKIIKSFGIDNNFYFEKIKEYID
HVKYFLFDFKSKIYGGSGKKFFWEKIYNYNFKVPFLLSGGINSNDFDKINNLNIPNLLGI
DLNSCFEKKPGLKNFNLLKQFISRIKYKYLSDYHGFYGNFGGAYIPEMLYNNINHLKNEY
NKIINNNCFKKKLKRLLHNYVGRPSPLFYCNNLSKIYGAKIYLKREDLNHTGSHKINNTI
GQALLAKEIGKKNIISETGAGQHGVATSTICSLLGLKCTIFMGEVDIKRQIQNVYRMKML
GANIIAVNSGSKTLKDSVNEAIRYWINNPDCYYMIGSAVGPDPYPRMVSYFQSIISEEIK
EQLKELPNYIIACLGGGSNAAGIFYHFLDDEYVKLIGVEASGLGLNTNKTAATIQKGSRG
VLHGSMTILMQDKYGQILEPYSISAGLDYPGIGPMHANLFYKNRATFISVTDFEAIEAGI
ELSSLEGIIPALESAHAIASLKKLSFKKNDLVIINMSGRGDKDMDTYIKHIENNE
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaaagaaaaataaaaatatgtggattaaaatactataataatatatcatcg
ataattgatttataccctgattttatcggattcattttttttgaaaaatctcctagattt
gtaggagataattttttagctcctgacacaattgggatttcaaaagttggtgtttttgta
aatgaaaaagaagataaattattaaaattaagtataaaaaataatttagattttgtacaa
ttacatggggacgaaagtccttattattgtaggaatatttataaaaagggaattaaaata
attaaatcttttggaatagataataatttttatttcgaaaaaataaaagaatatatagat
catgtaaaatattttttatttgactttaaatcaaaaatatatggaggtagtggaaaaaaa
tttttttgggaaaaaatttataattataactttaaagtaccatttcttttaagtggaggt
ataaattcaaatgattttgataaaataaataatttaaatatacccaatttattaggaata
gatttaaatagttgttttgaaaaaaaacctggattaaaaaattttaatttgttgaaacaa
ttcatttctagaataaaatataaatatttatcagattatcatggattttatggaaatttt
ggaggtgcgtatatacctgaaatgctatataataatataaatcatttaaaaaatgaatat
aataaaataataaacaataattgttttaaaaaaaaactaaaaagattattacataattat
gtaggaagaccgtctcctttgttttattgtaataatttatctaaaatatatggagctaaa
atctatttaaaaagagaagatttaaatcatactggatctcataaaataaataatacaatt
ggtcaagcgttattagctaaagaaattggaaaaaaaaatattatttcagaaacaggtgca
ggtcaacatggtgtggctacttccactatttgttctttattaggattaaaatgtactatt
tttatgggagaagtagatataaaacgacaaatacaaaatgtatataggatgaaaatgtta
ggggctaacataatagctgttaatagtggaagcaaaacattaaaagattcagtaaatgaa
gctattagatattggattaataatccagattgttattatatgatagggtcagcagtgggg
ccagatccatatcctagaatggtatcttactttcaatcaattattagtgaagaaataaaa
gaacaattaaaagaactacctaactatataattgcttgtttaggggggggaagtaatgct
gcaggtatattttatcattttttagatgatgaatatgttaagttaataggagtagaagca
tcaggattaggattaaatactaataaaacagcagcaacaatacaaaaaggctctagaggg
gtattacatgggagtatgactatacttatgcaagataaatatggacaaatattagaacct
tattctatatctgctggacttgattatccaggtataggtcctatgcatgcaaatttattt
tataaaaaccgtgctacttttataagtgttacagattttgaggctatagaagctggaatt
gaactatcttctttagaaggaataataccagcattagaaagtgctcatgctatagctagt
ttaaaaaaactttcatttaaaaaaaatgatttggtaatcataaatatgtctgggagaggt
gataaagatatggatacatatataaaacatattgaaaataatgaataa

DBGET integrated database retrieval system