KEGG   Candidatus Sulcia muelleri GWSS: SMGWSS_122Help
Entry
SMGWSS_122        CDS       T00630                                 

Definition
bifunctional phosphoribosylanthranilate isomerase/tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
K01817  
phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
smg  Candidatus Sulcia muelleri GWSS
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SMGWSS_122
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMGWSS_122
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SMGWSS_122
Enzymes [BR:smg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SMGWSS_122
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     SMGWSS_122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(118249..120036)
Genome map
AA seq 595 aa AA seqDB search
MFKKRKIKICGLKYYNNISSIIDLYPDFIGFIFFEKSPRFVGDNFLAPDTIGISKVGVFV
NEKEDKLLKLSIKNNLDFVQLHGDESPYYCRNIYKKGIKIIKSFGIDNNFYFEKIKEYID
HVKYFLFDFKSKIYGGSGKKFFWEKIYNYNFKVPFLLSGGINSNDFDKINNLNIPNLLGI
DLNSCFEKKPGLKNFNLLKQFISRIKYKYLSDYHGFYGNFGGAYIPEMLYNNINHLKNEY
NKIINNNCFKKKLKRLLHNYVGRPSPLFYCNNLSKIYGAKIYLKREDLNHTGSHKINNTI
GQALLAKEIGKKNIISETGAGQHGVATSTICSLLGLKCTIFMGEVDIKRQIQNVYRMKML
GANIIAVNSGSKTLKDSVNEAIRYWINNPDCYYMIGSAVGPDPYPRMVSYFQSIISEEIK
EQLKELPNYIIACLGGGSNAAGIFYHFLDDEYVKLIGVEASGLGLNTNKTAATIQKGSRG
VLHGSMTILMQDKYGQILEPYSISAGLDYPGIGPMHANLFYKNRATFISVTDFEAIEAGI
ELSSLEGIIPALESAHAIASLKKLSFKKNDLVIINMSGRGDKDMDTYIKHIENNE
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaaagaaaaataaaaatatgtggattaaaatactataataatatatcatcg
ataattgatttataccctgattttatcggattcattttttttgaaaaatctcctagattt
gtaggagataattttttagctcctgacacaattgggatttcaaaagttggtgtttttgta
aatgaaaaagaagataaattattaaaattaagtataaaaaataatttagattttgtacaa
ttacatggggacgaaagtccttattattgtaggaatatttataaaaagggaattaaaata
attaaatcttttggaatagataataatttttatttcgaaaaaataaaagaatatatagat
catgtaaaatattttttatttgactttaaatcaaaaatatatggaggtagtggaaaaaaa
tttttttgggaaaaaatttataattataactttaaagtaccatttcttttaagtggaggt
ataaattcaaatgattttgataaaataaataatttaaatatacccaatttattaggaata
gatttaaatagttgttttgaaaaaaaacctggattaaaaaattttaatttgttgaaacaa
ttcatttctagaataaaatataaatatttatcagattatcatggattttatggaaatttt
ggaggtgcgtatatacctgaaatgctatataataatataaatcatttaaaaaatgaatat
aataaaataataaacaataattgttttaaaaaaaaactaaaaagattattacataattat
gtaggaagaccgtctcctttgttttattgtaataatttatctaaaatatatggagctaaa
atctatttaaaaagagaagatttaaatcatactggatctcataaaataaataatacaatt
ggtcaagcgttattagctaaagaaattggaaaaaaaaatattatttcagaaacaggtgca
ggtcaacatggtgtggctacttccactatttgttctttattaggattaaaatgtactatt
tttatgggagaagtagatataaaacgacaaatacaaaatgtatataggatgaaaatgtta
ggggctaacataatagctgttaatagtggaagcaaaacattaaaagattcagtaaatgaa
gctattagatattggattaataatccagattgttattatatgatagggtcagcagtgggg
ccagatccatatcctagaatggtatcttactttcaatcaattattagtgaagaaataaaa
gaacaattaaaagaactacctaactatataattgcttgtttaggggggggaagtaatgct
gcaggtatattttatcattttttagatgatgaatatgttaagttaataggagtagaagca
tcaggattaggattaaatactaataaaacagcagcaacaatacaaaaaggctctagaggg
gtattacatgggagtatgactatacttatgcaagataaatatggacaaatattagaacct
tattctatatctgctggacttgattatccaggtataggtcctatgcatgcaaatttattt
tataaaaaccgtgctacttttataagtgttacagattttgaggctatagaagctggaatt
gaactatcttctttagaaggaataataccagcattagaaagtgctcatgctatagctagt
ttaaaaaaactttcatttaaaaaaaatgatttggtaatcataaatatgtctgggagaggt
gataaagatatggatacatatataaaacatattgaaaataatgaataa

DBGET integrated database retrieval system