KEGG   Candidatus Sulcia muelleri GWSS: SMGWSS_139Help
Entry
SMGWSS_139        CDS       T00630                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
smg  Candidatus Sulcia muelleri GWSS
Pathway
smg00260  Glycine, serine and threonine metabolism
smg01100  Metabolic pathways
smg01110  Biosynthesis of secondary metabolites
smg01120  Microbial metabolism in diverse environments
smg01230  Biosynthesis of amino acids
Module
smg_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:smg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMGWSS_139 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SMGWSS_139 (thrC)
Enzymes [BR:smg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SMGWSS_139 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ABS30550
UniProt: A8Z5Z9
Position
complement(139136..140440)
Genome map
AA seq 434 aa AA seqDB search
MLYKSLKNFNYKVPFKEAVLTGQSPEKGLYFPENIPVLNKTIIKNISNYDEHHLMMEVIQ
PFIGNEIPNKELLNIISNTVNFKINLNNIYDNIYSLELFLGPTMAFKDIGVKFMSGCIKY
FCKELNKNIIILTATSGDTGAAVANAFNKIDGVKVVILYPSSKISILQEKQITTLGNNII
ALEIKGNFDDCQMLVKKAFSDNQIRENLFITSANSINIARLLSQIFYYFMCYKLLLPIHY
NDKLIISIPSGNFGNICAGLIAFKMGLPVKQFIAATNINDTIPRLLRTGIYNTYPTQETI
SNAMDISDPSNFSRIMYMFKNVNNIKKLVSAYSFSDKETFEIIKSIWENYKYIMDPHGAI
GYLGLKQFIKNKKNNKKNIFLSTAAPVKFLDKISKGIDQKISLEKKVIKLLKKEKKSIQL
SNKYDTFKKWLLNL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgctgtataaaagtttaaaaaattttaactataaagttccttttaaggaagctgtttta
actggacaaagtccagaaaaaggtttgtattttcctgaaaatataccggttttaaacaaa
acaattattaaaaatatatcaaattatgatgaacatcatttaatgatggaagtaatacaa
cctttcattggaaatgaaattccaaataaagaattattaaatataatatctaatacagta
aattttaaaataaatcttaataatatttatgataatatttactcattagagttattttta
ggacctactatggcttttaaagatataggagtaaaatttatgtcagggtgtataaaatat
ttttgtaaagaacttaataaaaacattataatacttactgctacttctggtgatacagga
gctgcggtggctaatgctttcaataaaattgatggtgtcaaagtagttatattatatcct
tcttctaaaataagtattttacaagaaaaacagattacaacattaggaaataatattata
gctttagaaataaaaggtaattttgatgactgccaaatgttggtaaaaaaagctttttct
gacaaccaaatacgtgaaaatttatttataacctcagcaaattcaataaatattgcacgt
ttactatctcaaatattttattattttatgtgttataaacttttacttccaattcattac
aatgataaacttattatttctatacctagtggtaattttggaaatatatgtgcagggtta
atagcatttaaaatgggtttacctgtaaaacagtttattgcagctacaaatataaatgac
acaattcccagattgttaagaacaggtatttataatacatatcctacacaagaaacaatt
tctaatgctatggatatatctgatccaagtaattttagtcgtataatgtacatgtttaaa
aatgtaaataatataaaaaaacttgtatctgcatattctttttctgataaagaaacattt
gagattataaaatcaatttgggaaaattataaatatattatggatccacatggtgcaatt
ggatatttaggtttaaaacaatttattaaaaataaaaaaaataataaaaaaaatattttt
ttatcaacagctgctccagtgaaatttttagataaaatttctaagggaatagatcaaaaa
atttctttagaaaagaaagtaataaagcttctaaaaaaagaaaaaaaaagtatacaattg
agtaataaatatgacacttttaaaaagtggttattaaatttataa

DBGET integrated database retrieval system