KEGG   Candidatus Sulcia muelleri GWSS: SMGWSS_187Help
Entry
SMGWSS_187        CDS       T00630                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase, E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
smg  Candidatus Sulcia muelleri GWSS
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SMGWSS_187 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SMGWSS_187 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    SMGWSS_187 (sucB)
Enzymes [BR:smg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SMGWSS_187 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
182851..183996
Genome map
AA seq 381 aa AA seqDB search
MLLEITIPSPGESITEVEISSWLVKDGDFVKKNQVIAEIDSDKATLEIRAEESGILIIKA
KKGDILKVGEILCLIDTSFKKKTSEKKNISTKQSPSAKKILSQYKIDNKIDNKIDNKIAQ
TKHDAIKAIPSMGTKSLINRSFNVKRLSKLRRKLSERLVSVKNSTAMLTTFNEVDMSNIL
FLKKKYKDVFKEKHGVNLGFMPFFVKSCIKALKEYPNINSMIDKENQINFNYYDVSIAVS
GPKGLMVPVIRNADTLSFRGIEKTIKDLSNRIKNSTISIDDMTGGTFTITNGGIFGSMLS
TPIINPPQSAILGMHNIVERPVVILGKIEIRPIMYLALSYDHRIIDGKEAVGFLFSIKKS
IENPINSLIGSENELNNYFEL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgttattagaaataacaattccttctccaggagaatcaataacagaagttgaaatatca
tcttggttagttaaagatggtgattttgtaaaaaaaaatcaagtaattgcagaaatagat
tcagataaggcaactttagaaatacgtgcagaagaaagtggaattttaattataaaagct
aaaaaaggagacattttaaaagtaggagaaatattatgtttaatagatacttcttttaaa
aaaaaaacatcagaaaaaaagaatatttcgacaaaacaatctccatcagcaaaaaaaata
ttaagtcaatataaaatagataataaaatagataataaaatagataataaaatagcccaa
acaaaacatgatgctattaaagcaattccgtctatgggaactaaaagtttaattaataga
tcttttaacgtaaaaagattatctaaacttagacgtaaattatcagaaagacttgtttca
gtaaaaaattcaacagctatgctgactacttttaatgaagtagatatgagtaatattttg
tttttaaaaaaaaaatataaagatgtttttaaagaaaaacatggagtgaatttagggttt
atgcctttttttgtaaaatcttgtataaaagcgttaaaagaatatcctaatattaattct
atgatagataaggaaaatcaaattaattttaattattatgatgtaagtattgcagtttct
ggacctaaaggattaatggtgccagttattagaaatgcagatactctttcttttagaggt
atagaaaaaactataaaagatttatctaatcgtataaaaaattcaactatatctatagat
gatatgactggaggtacttttacaataacaaatgggggaatttttggttctatgttatct
actcctataataaatccaccccaaagtgctatattaggtatgcataatatagtagaaaga
ccggtagtaattttaggaaaaatcgaaattagaccaattatgtatttagcattatcttat
gatcatagaatcatagatggtaaagaagcagtgggttttttattttcaataaagaaatca
atagaaaatcctataaattctttaataggttcagaaaacgaattaaataattattttgaa
ttatag

DBGET integrated database retrieval system