KEGG   Candidatus Sulcia muelleri GWSS: SMGWSS_187Help
Entry
SMGWSS_187        CDS       T00630                                 

Gene name
sucB
Definition
(RefSeq) 2-oxoglutarate dehydrogenase, E2 component
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
smg  Candidatus Sulcia muelleri GWSS
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SMGWSS_187 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SMGWSS_187 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    SMGWSS_187 (sucB)
Enzymes [BR:smg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SMGWSS_187 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
182851..183996
Genome map
AA seq 381 aa AA seqDB search
MLLEITIPSPGESITEVEISSWLVKDGDFVKKNQVIAEIDSDKATLEIRAEESGILIIKA
KKGDILKVGEILCLIDTSFKKKTSEKKNISTKQSPSAKKILSQYKIDNKIDNKIDNKIAQ
TKHDAIKAIPSMGTKSLINRSFNVKRLSKLRRKLSERLVSVKNSTAMLTTFNEVDMSNIL
FLKKKYKDVFKEKHGVNLGFMPFFVKSCIKALKEYPNINSMIDKENQINFNYYDVSIAVS
GPKGLMVPVIRNADTLSFRGIEKTIKDLSNRIKNSTISIDDMTGGTFTITNGGIFGSMLS
TPIINPPQSAILGMHNIVERPVVILGKIEIRPIMYLALSYDHRIIDGKEAVGFLFSIKKS
IENPINSLIGSENELNNYFEL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgttattagaaataacaattccttctccaggagaatcaataacagaagttgaaatatca
tcttggttagttaaagatggtgattttgtaaaaaaaaatcaagtaattgcagaaatagat
tcagataaggcaactttagaaatacgtgcagaagaaagtggaattttaattataaaagct
aaaaaaggagacattttaaaagtaggagaaatattatgtttaatagatacttcttttaaa
aaaaaaacatcagaaaaaaagaatatttcgacaaaacaatctccatcagcaaaaaaaata
ttaagtcaatataaaatagataataaaatagataataaaatagataataaaatagcccaa
acaaaacatgatgctattaaagcaattccgtctatgggaactaaaagtttaattaataga
tcttttaacgtaaaaagattatctaaacttagacgtaaattatcagaaagacttgtttca
gtaaaaaattcaacagctatgctgactacttttaatgaagtagatatgagtaatattttg
tttttaaaaaaaaaatataaagatgtttttaaagaaaaacatggagtgaatttagggttt
atgcctttttttgtaaaatcttgtataaaagcgttaaaagaatatcctaatattaattct
atgatagataaggaaaatcaaattaattttaattattatgatgtaagtattgcagtttct
ggacctaaaggattaatggtgccagttattagaaatgcagatactctttcttttagaggt
atagaaaaaactataaaagatttatctaatcgtataaaaaattcaactatatctatagat
gatatgactggaggtacttttacaataacaaatgggggaatttttggttctatgttatct
actcctataataaatccaccccaaagtgctatattaggtatgcataatatagtagaaaga
ccggtagtaattttaggaaaaatcgaaattagaccaattatgtatttagcattatcttat
gatcatagaatcatagatggtaaagaagcagtgggttttttattttcaataaagaaatca
atagaaaatcctataaattctttaataggttcagaaaacgaattaaataattattttgaa
ttatag

DBGET integrated database retrieval system