KEGG   Candidatus Sulcia muelleri GWSS: SMGWSS_255Help
Entry
SMGWSS_255        CDS       T00630                                 

Gene name
aceF
Definition
dihydrolipoamide acyltransferase E2 component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
smg  Candidatus Sulcia muelleri GWSS
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SMGWSS_255 (aceF)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMGWSS_255 (aceF)
   00020 Citrate cycle (TCA cycle)
    SMGWSS_255 (aceF)
   00620 Pyruvate metabolism
    SMGWSS_255 (aceF)
Enzymes [BR:smg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SMGWSS_255 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
234246..235361
Genome map
AA seq 371 aa AA seqDB search
MAEVIFMPRLSDTMVVGTVVKWHKKIGDKILEGDILAEIETDKAIQELEAEYNSTLLYIG
IKEGESAPVNSNSVLAILGSENEDISSLLKQNKINYKRILISPLAKKLAFDKGISLDNIK
GTGINGRIIKKDIERYIDNNLDKTISSNEVNHSNIRKIISKRLINSKIESPHYSLFIEVI
MDNLIKLRDSINEKKYLDKISFNDLIVKASALAIKENPKINSSWTEKSILYHNNINIGIA
VALEDGLIVPVINQVNEKSLRQISFEIKEKVIKAKEKKIQSNELEGSTFTVSNLGMFGID
SFTSIINQPNSCILSVGSIKKKPIINNDKIVIGHTTKFTLTCDHRIIDGAVGSDYLKSLK
KLLQEPLNIII
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagttatatttatgcctcgtctaagtgatactatggtagtaggtactgttgta
aaatggcataaaaagataggtgataaaattttagaaggagatattttagcggaaatagag
actgataaagcaattcaggaattggaagctgaatataattctacattgctttatattgga
atcaaagaaggagaaagtgccccagtaaatagtaatagtgtattagctattttaggttct
gaaaatgaagatattagttctttgctaaagcaaaataaaattaattataaaagaattttg
atttctcctttagctaaaaaattagcttttgataaaggcatatcattagataatattaaa
ggtactggaattaatggacgaattataaaaaaagatatagaaagatatattgataataat
ttagataaaacaattagttctaatgaagttaaccattctaatattagaaaaataattagc
aaaagattaattaattctaaaattgaatcacctcattattctttatttatagaagtaatt
atggataatttaattaaattaagagactcgattaacgaaaaaaaatatttagataaaata
tcttttaatgatttaattgtgaaagcttcagctttagctataaaagaaaatccaaaaata
aattcttcttggacagaaaaaagtatattataccataataatataaatataggtatagca
gtagcattagaagatggtttaattgttcctgtaattaatcaggtaaatgaaaaatcttta
agacaaatttcttttgaaataaaagaaaaagtaataaaagctaaagaaaaaaaaattcaa
tctaatgaattagaaggtagtacttttactgtttcaaatcttggaatgtttggtatagat
tcatttacttctattataaatcaacctaattcttgtattttatctgtaggaagtattaaa
aaaaaacctattataaataatgataaaattgtaataggtcatactactaaatttacatta
acatgtgatcatagaattatagatggtgcagtaggtagtgattatttaaaaagtttaaaa
aaattattacaagagccattaaatataattatttaa

DBGET integrated database retrieval system