KEGG   Candidatus Sulcia muelleri GWSS: SMGWSS_255Help
Entry
SMGWSS_255        CDS       T00630                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide acyltransferase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
smg  Candidatus Sulcia muelleri GWSS
Pathway
smg00010  Glycolysis / Gluconeogenesis
smg00020  Citrate cycle (TCA cycle)
smg00620  Pyruvate metabolism
smg01100  Metabolic pathways
smg01110  Biosynthesis of secondary metabolites
smg01120  Microbial metabolism in diverse environments
smg01130  Biosynthesis of antibiotics
smg01200  Carbon metabolism
Module
smg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMGWSS_255 (aceF)
   00020 Citrate cycle (TCA cycle)
    SMGWSS_255 (aceF)
   00620 Pyruvate metabolism
    SMGWSS_255 (aceF)
Enzymes [BR:smg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SMGWSS_255 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118 PYNP_C eIF3_subunit
Motif
Other DBs
NCBI-ProteinID: ABS30651
UniProt: A8Z6A0
Position
234246..235361
Genome map
AA seq 371 aa AA seqDB search
MAEVIFMPRLSDTMVVGTVVKWHKKIGDKILEGDILAEIETDKAIQELEAEYNSTLLYIG
IKEGESAPVNSNSVLAILGSENEDISSLLKQNKINYKRILISPLAKKLAFDKGISLDNIK
GTGINGRIIKKDIERYIDNNLDKTISSNEVNHSNIRKIISKRLINSKIESPHYSLFIEVI
MDNLIKLRDSINEKKYLDKISFNDLIVKASALAIKENPKINSSWTEKSILYHNNINIGIA
VALEDGLIVPVINQVNEKSLRQISFEIKEKVIKAKEKKIQSNELEGSTFTVSNLGMFGID
SFTSIINQPNSCILSVGSIKKKPIINNDKIVIGHTTKFTLTCDHRIIDGAVGSDYLKSLK
KLLQEPLNIII
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagttatatttatgcctcgtctaagtgatactatggtagtaggtactgttgta
aaatggcataaaaagataggtgataaaattttagaaggagatattttagcggaaatagag
actgataaagcaattcaggaattggaagctgaatataattctacattgctttatattgga
atcaaagaaggagaaagtgccccagtaaatagtaatagtgtattagctattttaggttct
gaaaatgaagatattagttctttgctaaagcaaaataaaattaattataaaagaattttg
atttctcctttagctaaaaaattagcttttgataaaggcatatcattagataatattaaa
ggtactggaattaatggacgaattataaaaaaagatatagaaagatatattgataataat
ttagataaaacaattagttctaatgaagttaaccattctaatattagaaaaataattagc
aaaagattaattaattctaaaattgaatcacctcattattctttatttatagaagtaatt
atggataatttaattaaattaagagactcgattaacgaaaaaaaatatttagataaaata
tcttttaatgatttaattgtgaaagcttcagctttagctataaaagaaaatccaaaaata
aattcttcttggacagaaaaaagtatattataccataataatataaatataggtatagca
gtagcattagaagatggtttaattgttcctgtaattaatcaggtaaatgaaaaatcttta
agacaaatttcttttgaaataaaagaaaaagtaataaaagctaaagaaaaaaaaattcaa
tctaatgaattagaaggtagtacttttactgtttcaaatcttggaatgtttggtatagat
tcatttacttctattataaatcaacctaattcttgtattttatctgtaggaagtattaaa
aaaaaacctattataaataatgataaaattgtaataggtcatactactaaatttacatta
acatgtgatcatagaattatagatggtgcagtaggtagtgattatttaaaaagtttaaaa
aaattattacaagagccattaaatataattatttaa

DBGET integrated database retrieval system