KEGG   Candidatus Sulcia muelleri DMIN: DMIN_00770Help
Entry
DMIN_00770        CDS       T01203                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
smh  Candidatus Sulcia muelleri DMIN
Pathway
smh00020  Citrate cycle (TCA cycle)
smh00640  Propanoate metabolism
smh00660  C5-Branched dibasic acid metabolism
smh01100  Metabolic pathways
smh01110  Biosynthesis of secondary metabolites
smh01120  Microbial metabolism in diverse environments
smh01130  Biosynthesis of antibiotics
smh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DMIN_00770
   00640 Propanoate metabolism
    DMIN_00770
   00660 C5-Branched dibasic acid metabolism
    DMIN_00770
Enzymes [BR:smh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     DMIN_00770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ADE35374
UniProt: D5D8K2
Position
77092..78270
Genome map
AA seq 392 aa AA seqDB search
MNLHEYQAKKILATFGVKVPYSINALNIEETVYAAKKVFKKTKEYICVIKAQIHAGGRGK
GGGIKISKYIDDVYKKSSNILGRRLVTNQTNNKGKIVNKVLISEYVFNTEKENEYYISIF
YDRNIYKNRILYSKEGGLEIESKYRYKKIFFQKIDPYIGIQDFLIRKIAFNLKIKYSAFI
RFKTFIRNIYNAYIYSDASLLEINPVFITKNNEILAIDAKVILDDNALFRHMDYKEMYDE
KEYDLIELEAKKAGLNYLKLDGEVACMVNGAGLAMSTMDMIKLYGANPANFLDLGGKADS
KCIKKGFDIILKDKKVKIILINIFGGIVRCDIVAEGIINYFNKSINKKIILRLEGTNVNL
AKKLINNSIINNSIIYVTSLEEAANKIKKIII
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacatgaatatcaagctaagaaaatattagcaacttttggggtaaaagttcct
tatagtattaatgctttaaatattgaagaaacggtatatgctgctaaaaaagtatttaaa
aaaacgaaagaatatatttgtgtaataaaagctcaaatacatgctgggggacgtggaaag
ggaggtggaataaaaatatctaaatatatagatgacgtatataaaaaatcatcaaatatc
cttggtaggagattagtaactaatcaaacaaataataaaggtaaaattgtaaataaagtt
cttatatcagaatatgtttttaatactgaaaaagagaacgaatattatatatctatattc
tatgatagaaatatatataaaaatagaattctatattctaaagagggaggtttagaaata
gaatctaaatatagatataaaaagatatttttccaaaaaatagatccttatataggaata
caagattttttaattcgaaaaatagcatttaatttaaaaattaaatattcagcttttatt
aggtttaaaacatttataagaaatatatataatgcatatatatattctgatgcttctctt
ttggagataaatccagttttcataactaaaaataatgaaatattagcaatagatgctaaa
gtaatattagatgataatgctttgtttcgtcatatggattataaagaaatgtatgatgaa
aaagaatatgatctaatagaattagaagctaaaaaagcaggtttaaattatctaaagtta
gatggggaggtagcatgtatggtaaatggagcaggtttagcaatgtctactatggatatg
ataaaactatatggagctaatccagctaattttttagatttaggtggtaaagcagattca
aaatgtataaaaaaaggatttgatataatcttaaaagataaaaaagtaaaaataatatta
ataaatatttttggaggaattgttcgatgtgatatagttgctgaaggcattataaattat
tttaataaaagtataaataagaaaattattctaaggttagaaggtacaaatgtaaattta
gcaaaaaaactaataaataatagtataataaataatagtataatatatgtaacttctctt
gaagaagctgctaataaaataaaaaaaattataatataa

DBGET integrated database retrieval system