KEGG   Candidatus Sulcia muelleri DMIN: DMIN_01170Help
Entry
DMIN_01170        CDS       T01203                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
smh  Candidatus Sulcia muelleri DMIN
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DMIN_01170
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DMIN_01170
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DMIN_01170
Enzymes [BR:smh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DMIN_01170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(116327..117082)
Genome map
AA seq 251 aa AA seqDB search
MNKIKRLFINKKKNILNIYFTAGYPSIDSMPLILKRLQNLNIDIVEIGIPYSDPLADGNL
IQKSNTKSLKNGMNISVLFYKLKKVKKYINIPIILMGYYNQFIKYGEIKFLEDCIESGVS
GLILPDLPPRIYLNKYKKIFKKYKLAFIVLITPQTSLKRLKRLSSITDYFLYIVSSNSTT
GTKNNINLSFLERIKEINVPKLIGFGICDKKSLNIAFKYAEGAIIGSAFIKAIKKSYLEK
SIEKFIKYIIK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaataaaaagattatttataaataaaaaaaaaaatatattaaatatatatttc
actgctggctatccatctatagatagtatgccacttatcttaaaaagattacagaatcta
aatatagatatagtagaaattggaataccatattctgatccattagcagatggaaatcta
atacaaaaaagtaatacaaaatctttaaaaaatgggatgaatatatccgttttattttat
aaacttaaaaaagtaaaaaaatatataaatattccaataattttaatgggatattataat
caatttataaaatatggcgaaataaaatttttagaagattgtatagaatctggtgtatct
ggattaattttaccagacttacctccaaggatttacctaaataaatataaaaaaatattt
aaaaaatataaattagcatttatagttttaattactcctcaaacatctttaaaacgtctt
aaaaggttaagtagtattactgattattttttatatatagtttcatctaattctactaca
ggtactaaaaataatataaatttatcatttctagaaagaataaaagaaataaatgttcct
aaacttattggttttggaatatgtgataaaaaatcattaaatatagcatttaaatatgct
gaaggagcaattattggaagtgcttttataaaagctattaaaaagtcttatttagaaaaa
agtatagaaaaatttataaaatatattataaaatag

DBGET integrated database retrieval system