KEGG   Candidatus Sulcia muelleri DMIN: DMIN_01180Help
Entry
DMIN_01180        CDS       T01203                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
K01817  
phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
smh  Candidatus Sulcia muelleri DMIN
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DMIN_01180
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DMIN_01180
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DMIN_01180
Enzymes [BR:smh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DMIN_01180
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     DMIN_01180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(117075..118874)
Genome map
AA seq 599 aa AA seqDB search
MFKKRKIKICGLKYYNNISSIIDLYPDFIGFIFFEKSPRFVGDNFLAPDTIGISKVGVFV
NEKEDKLLKLSIKNNLDFVQLHGDESPYYCRNIYKKGIKIIKSFGIDNNFYFEKIKEYID
HVKYFLFDFKSKIYGGSGKKFFWEKIYNYNFKVPFILSGGINSNDFDKINNLNIPNLLGI
DLNSCFENKPGLKNFNLLKKFISRIKYKYLSDYHGFYGNFGGAYIPEMLYNNINNLKNEY
NKIINNNCFKKKLKRLLHNYVGRPSPLFYCNNLSKIYGAKIYLKREDLNHTGSHKINNTI
GQALLAKEIGKKNIISETGAGQHGVATSTICSLLGLKCTIFMGEVDIKRQIQNVYRMKML
GANIIAVNSGSKTLKDSVNEAIRYWINNPDCYYMIGSAVGPDPYPRMVSYFQSIISEEIK
EQLKEKEGILPNYIIACLGGGSNAAGIFYHFLDDEYVKLIGVEASGLGLNTNKTAATIQK
GSRGVLHGSMTILMQDKYGQILEPYSISAGLDYPGIGPMHANLFYKNRATFISVTDFEAI
EAGIELSSLEGIIPALESAHAIASLKKLSFKKNDLVIINMSGRGDKDMDTYIKHIENNE
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaaagaaaaataaaaatatgtggattaaaatactataataatatatcatcg
ataattgatttataccctgattttatcggattcattttttttgaaaaatctcctagattt
gtaggagataattttttagctcctgacacaattgggatttcaaaagttggtgtttttgta
aatgaaaaagaagataaattattaaaattaagtataaaaaataatttagattttgtacaa
ttacatggggacgaaagtccttattattgtaggaatatttataaaaagggaattaaaata
attaaatcttttggaatagataataatttttatttcgaaaaaataaaagaatatatagat
catgtaaaatattttttatttgactttaaatcaaaaatatatggaggtagtggaaaaaaa
tttttttgggaaaaaatttataattataactttaaagtaccatttattttaagtggaggt
ataaattcaaatgattttgataaaataaataatttaaatatacccaatttattaggaata
gatttaaatagttgttttgaaaacaaacctggattaaaaaattttaatttgttgaaaaaa
ttcatttctagaataaaatataaatatttatcagattatcatggattttatggaaatttt
ggaggtgcgtatatacctgaaatgctatataataatataaataatttaaaaaatgaatat
aataaaataataaacaataattgttttaaaaaaaaactaaaaagattattacataattat
gtaggaagaccgtctcctttgttttattgtaataatttatctaaaatatatggagctaaa
atatatttaaaaagagaagatttaaatcatactggatctcataaaataaataatacaatt
ggtcaagcgttattagctaaagaaattggaaaaaaaaatattatttcagaaacaggtgca
ggtcaacatggtgtggctacttccactatttgttctttattaggattaaaatgtactatt
tttatgggagaagtagatataaaacgacaaatacaaaatgtatataggatgaaaatgtta
ggggctaacataatagctgttaatagtggaagcaaaacattaaaagattcagtaaatgaa
gctattagatattggattaataatccagattgttattatatgatagggtcagcagtgggg
ccagatccatatcctagaatggtatcttactttcaatcaattattagtgaagaaataaaa
gaacaattaaaagaaaaagaaggtatactacctaactatataattgcttgtttagggggg
ggaagtaatgctgcaggtatattttatcattttttagatgatgaatatgttaagttaata
ggagtagaagcatcaggattaggattaaatactaataaaacagcagcaacaatacaaaaa
ggctctagaggggtattacatggaagtatgactatacttatgcaagataaatatggacaa
atattagaaccttattctatatctgctggacttgattatccaggtataggtcctatgcat
gcaaatttattttataaaaaccgtgctacttttataagtgttacagattttgaggctata
gaagctggaattgaactatcttctttagaaggaataataccagcattagaaagtgctcat
gctatagctagtttaaaaaaactttcatttaaaaaaaatgatttggtaatcataaatatg
tctgggagaggtgataaagatatggatacatatataaaacatattgaaaataatgaataa

DBGET integrated database retrieval system