KEGG   Candidatus Sulcia muelleri DMIN: DMIN_01350Help
Entry
DMIN_01350        CDS       T01203                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
smh  Candidatus Sulcia muelleri DMIN
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:smh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DMIN_01350
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DMIN_01350
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DMIN_01350
Enzymes [BR:smh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DMIN_01350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(138529..139833)
Genome map
AA seq 434 aa AA seqDB search
MLYKSLKNFNYKVPFKEAVLTGQSPEKGLYFPENIPVLNKTIIKNISNYDEHHLMMEVIQ
PFIVNEIPNKELLNIISNTVNFKININNIYDNIYSLELFLGPTMAFKDIGVKFMSGCIKY
FCKELNKNIIILTATSGDTGAAVANAFNKIDGVKVVILYPSSKISILQEKQITTLGNNII
ALEIKGNFDDCQMLVKKAFSDNQIRENLFITSANSINIARLLSQIFYYFMCYKLLLPIHY
NDKLIISIPSGNFGNICAGLIAFKMGLPVKQFIAATNINDTIPRLLRTGIYNTYPTQETI
SNAMDISDPSNFSRIMYMFKNVNNIKKLVSAYSFSDKETFEIIKSIWENYKYIMDPHGAI
GYLGLKQFIKNKKNNKKNIFLSTAAPVKFLDKISKGIDQKISLEKKVIKLLKKEKKSIQL
SNKYDTFKNWLLNL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgctgtataaaagtttaaaaaattttaactataaagttccttttaaggaagctgtttta
actggacaaagtccagaaaaaggtttgtattttcctgaaaatataccggttttaaacaaa
acaattattaaaaatatatcaaattatgatgaacatcatttaatgatggaagtaatacaa
cctttcattgtaaatgaaattccaaataaagaattattaaatataatatctaatacagta
aattttaaaataaatattaataatatttatgataatatttactcattagagttattttta
ggacctactatggcttttaaagatataggagtaaaatttatgtcagggtgtatcaaatat
ttttgtaaagaacttaataaaaacattataatacttactgctacttctggtgatacagga
gctgcggtggctaatgctttcaataaaattgatggtgtaaaagtagttatattatatcct
tcttctaaaataagtattttacaagaaaaacagattacaacattaggaaataatattata
gctttagaaataaaaggtaattttgatgactgccaaatgttggtaaaaaaagctttttct
gacaaccaaatacgtgaaaatttatttataacctcagcaaattcaataaatattgcacgt
ttactatctcaaatattttattattttatgtgttataaacttttacttccaattcattac
aatgataaacttattatttctatacctagtggtaattttggaaatatatgtgcagggtta
atagcatttaaaatgggtttacctgtaaaacagtttattgcagctacaaatataaatgac
acaattcccagattgttaagaacaggtatttataatacatatcctacacaagaaacaatt
tctaatgctatggatatatctgatccaagtaattttagtcgtataatgtacatgtttaaa
aatgtaaataatataaaaaaacttgtatctgcatattctttttctgataaagaaacattt
gagattataaaatcaatttgggaaaattataaatatattatggatccacatggagcaatt
ggatatttaggtttaaaacaatttattaaaaataaaaaaaataataaaaaaaatattttt
ttatcaacagctgctccagtgaaatttttagataaaatttctaagggaatagatcaaaaa
atttctttagaaaagaaagtaataaagcttctaaaaaaagaaaaaaaaagtatacaattg
agtaataaatatgacacttttaaaaactggttattaaatttataa

DBGET integrated database retrieval system