KEGG   Candidatus Sulcia muelleri DMIN: DMIN_01820Help
Entry
DMIN_01820        CDS       T01203                                 

Definition
2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
smh  Candidatus Sulcia muelleri DMIN
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DMIN_01820
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DMIN_01820
  Amino acid metabolism
   00310 Lysine degradation
    DMIN_01820
Enzymes [BR:smh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     DMIN_01820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
181571..182698
Genome map
AA seq 375 aa AA seqDB search
MLLEITIPSPGESITEVEISSWLVKDGDFVKKNQVIAEIDSDKATLEIRAEESGILIIKA
KKGDILKVGEILCLIDTSFKKKTSEKKNISTKQSPSAKKILSQYKIDNKIDIAQKKHDAI
KAIPSMGTKSLINRSFNVKRLSKLRRKLSERLVSVKNETAMLTTFNEVDMSNILFLKKKY
KDVFKEKHGVNLGFMPFFVKSCIKALKEYPNINSMIDKENQINFNYYDVSIAVSGPKGLM
VPVIRNADTLSFRGIEKTIKDLSNRIKNSTISIDDMTGGTFTITNGGIFGSMLSTPIINP
PQSAILGMHNIVERPVVILGKIEIRPIMYLALSYDHRIIDGKEAVGFLFSIKKSIENPIN
SLIGSENELNNYFEL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgttattagaaataacaattccttctccaggagaatcaataacagaagttgaaatatca
tcttggttagttaaagatggtgattttgtaaaaaaaaatcaagtaattgcagaaatagat
tcagataaggcaactttagaaatacgtgcagaagaaagtggaattttaattataaaagct
aaaaaaggagacattttaaaagtaggagaaatattatgtttaatagatacttcttttaaa
aaaaaaacatcagaaaaaaagaatatttcgacaaaacaatctccatcagcaaaaaaaata
ttaagtcaatataaaatagataataaaatagatatagcccaaaaaaaacatgatgctatt
aaagcaattccgtctatgggaactaaaagtttaattaatagatcttttaacgtaaaaaga
ttatctaaacttagacgtaaattatcagaaagacttgtttcagtaaaaaatgaaacagct
atgctgactacttttaatgaagtagatatgagtaatattttgtttttaaaaaaaaaatat
aaagatgtttttaaagaaaaacatggagttaatttagggtttatgcctttttttgtaaaa
tcttgtataaaagcgttaaaagaatatcctaatattaattctatgatagataaggaaaat
caaattaattttaattattatgatgtaagtattgcagtttctggacctaaaggattaatg
gtgccagttattagaaatgcagatactctttcttttagaggtatagaaaaaactataaaa
gatttatctaatcgtataaaaaattcaactatatctatagatgatatgactggaggtact
tttacaataacaaatgggggaatttttggttctatgttatctactcctataataaatcca
ccccaaagtgctatattaggtatgcataatatagtagaaagaccggtagtaattttagga
aaaatcgaaattagaccaattatgtatttagcattatcttatgatcatagaatcatagat
ggtaaagaagcagtgggttttttattttcaataaagaaatcaatagaaaatcctataaat
tctttaataggttcagaaaacgaattaaataattattttgaattatag

DBGET integrated database retrieval system