KEGG   Candidatus Sulcia muelleri DMIN: DMIN_01820Help
Entry
DMIN_01820        CDS       T01203                                 

Definition
2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
smh  Candidatus Sulcia muelleri DMIN
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DMIN_01820
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DMIN_01820
  Amino acid metabolism
   00310 Lysine degradation
    DMIN_01820
Enzymes [BR:smh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     DMIN_01820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
181571..182698
Genome map
AA seq 375 aa AA seqDB search
MLLEITIPSPGESITEVEISSWLVKDGDFVKKNQVIAEIDSDKATLEIRAEESGILIIKA
KKGDILKVGEILCLIDTSFKKKTSEKKNISTKQSPSAKKILSQYKIDNKIDIAQKKHDAI
KAIPSMGTKSLINRSFNVKRLSKLRRKLSERLVSVKNETAMLTTFNEVDMSNILFLKKKY
KDVFKEKHGVNLGFMPFFVKSCIKALKEYPNINSMIDKENQINFNYYDVSIAVSGPKGLM
VPVIRNADTLSFRGIEKTIKDLSNRIKNSTISIDDMTGGTFTITNGGIFGSMLSTPIINP
PQSAILGMHNIVERPVVILGKIEIRPIMYLALSYDHRIIDGKEAVGFLFSIKKSIENPIN
SLIGSENELNNYFEL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgttattagaaataacaattccttctccaggagaatcaataacagaagttgaaatatca
tcttggttagttaaagatggtgattttgtaaaaaaaaatcaagtaattgcagaaatagat
tcagataaggcaactttagaaatacgtgcagaagaaagtggaattttaattataaaagct
aaaaaaggagacattttaaaagtaggagaaatattatgtttaatagatacttcttttaaa
aaaaaaacatcagaaaaaaagaatatttcgacaaaacaatctccatcagcaaaaaaaata
ttaagtcaatataaaatagataataaaatagatatagcccaaaaaaaacatgatgctatt
aaagcaattccgtctatgggaactaaaagtttaattaatagatcttttaacgtaaaaaga
ttatctaaacttagacgtaaattatcagaaagacttgtttcagtaaaaaatgaaacagct
atgctgactacttttaatgaagtagatatgagtaatattttgtttttaaaaaaaaaatat
aaagatgtttttaaagaaaaacatggagttaatttagggtttatgcctttttttgtaaaa
tcttgtataaaagcgttaaaagaatatcctaatattaattctatgatagataaggaaaat
caaattaattttaattattatgatgtaagtattgcagtttctggacctaaaggattaatg
gtgccagttattagaaatgcagatactctttcttttagaggtatagaaaaaactataaaa
gatttatctaatcgtataaaaaattcaactatatctatagatgatatgactggaggtact
tttacaataacaaatgggggaatttttggttctatgttatctactcctataataaatcca
ccccaaagtgctatattaggtatgcataatatagtagaaagaccggtagtaattttagga
aaaatcgaaattagaccaattatgtatttagcattatcttatgatcatagaatcatagat
ggtaaagaagcagtgggttttttattttcaataaagaaatcaatagaaaatcctataaat
tctttaataggttcagaaaacgaattaaataattattttgaattatag

DBGET integrated database retrieval system