KEGG   Candidatus Sulcia muelleri DMIN: DMIN_02500Help
Entry
DMIN_02500        CDS       T01203                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component-related enzyme (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
smh  Candidatus Sulcia muelleri DMIN
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DMIN_02500
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DMIN_02500
   00020 Citrate cycle (TCA cycle)
    DMIN_02500
   00620 Pyruvate metabolism
    DMIN_02500
Enzymes [BR:smh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DMIN_02500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
232580..233815
Genome map
AA seq 411 aa AA seqDB search
MAEVIFMPRLSDTMVVGTVVKWHKKIGDKILEGDILAEIETDKAIQELEAEYNSTLLYIG
IKEGESAPVNSNSVLAILGSENEDISSLLKQNQINYKRIFISPLAKKLAFDKGISLDNIK
GTGINGRIIKKDIERYIDNNLDKTSNEVNEVNEVNEVNEVNEVNEVNEVNEVNEVNEVNE
VNHSNEVNEVNHSNIRKIISKRLINSKIESPHYSLFIEVIMDNLIKLRDSINEKKYLDKI
SFNDLIVKASALAIKENPKINSSWTEKSILYHNNINIGIAVALEDGLIVPVINQVNEKSL
RQISFEIKEKVIKAKEKKIQSNELEGSTFTVSNLGMFGIDSFTSIINQPNSCILSVGSIK
KKPIINNDKIVIGHTTKFTLTCDHRIIDGAVGSDYLKSLKKLLQEPLNIII
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagttatatttatgcctcgtctaagtgatactatggtagtaggtactgttgta
aaatggcataaaaagataggtgataaaattttagaaggagatattttagcggaaatagag
actgataaagcaattcaggaattggaagctgaatataattctacattgctttatattgga
atcaaagaaggagaaagtgccccagtaaatagtaatagtgtattagctattttaggttct
gaaaatgaagatattagttctttgctaaagcaaaatcaaattaattataaaagaattttt
atttctcctttagctaaaaaattagcttttgataaaggcatatcattagataatattaaa
ggtactggaattaatggacgaattataaaaaaagatatagaaagatatattgataataat
ttagataaaacatctaatgaagttaatgaagttaatgaagttaatgaagttaatgaagtt
aatgaagttaatgaagttaatgaagttaatgaagttaatgaagttaatgaagttaatgaa
gttaaccattctaatgaagttaatgaagttaaccattctaatattagaaaaataattagc
aaaagattaattaattctaaaattgaatcacctcattattctttatttatagaagtaatt
atggataatttaattaaattaagagactcgattaacgaaaaaaaatatttagataaaata
tcttttaatgatttaattgtgaaagcttcagctttagctataaaagaaaatccaaaaata
aattcttcttggacagaaaaaagtatattataccataataatataaatataggtatagca
gtagcattagaagatggtttaattgttcctgtaattaatcaggtaaatgaaaaatcttta
agacaaatttcttttgaaataaaagaaaaagtaataaaagctaaagaaaaaaaaattcaa
tctaatgaattagaaggtagtacttttactgtttcaaatcttggaatgtttggtatagat
tcatttacttctattataaatcaacctaattcttgtattttatctgtaggaagtattaaa
aaaaaacctattataaataatgataaaattgtaataggtcatactactaaatttacatta
acatgtgatcatagaattatagatggtgcagtaggtagtgattatttaaaaagtttaaaa
aaattattacaagagccattaaatataattatttaa

DBGET integrated database retrieval system