KEGG   Candidatus Sulcia muelleri DMIN: DMIN_02500Help
Entry
DMIN_02500        CDS       T01203                                 

Definition
(GenBank) Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component-related enzyme
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
smh  Candidatus Sulcia muelleri DMIN
Pathway
smh00010  Glycolysis / Gluconeogenesis
smh00020  Citrate cycle (TCA cycle)
smh00620  Pyruvate metabolism
smh01100  Metabolic pathways
smh01110  Biosynthesis of secondary metabolites
smh01120  Microbial metabolism in diverse environments
smh01130  Biosynthesis of antibiotics
smh01200  Carbon metabolism
Module
smh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DMIN_02500
   00020 Citrate cycle (TCA cycle)
    DMIN_02500
   00620 Pyruvate metabolism
    DMIN_02500
Enzymes [BR:smh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DMIN_02500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 PYNP_C eIF3_subunit
Motif
Other DBs
NCBI-ProteinID: ADE35528
UniProt: D5D906
Position
232580..233815
Genome map
AA seq 411 aa AA seqDB search
MAEVIFMPRLSDTMVVGTVVKWHKKIGDKILEGDILAEIETDKAIQELEAEYNSTLLYIG
IKEGESAPVNSNSVLAILGSENEDISSLLKQNQINYKRIFISPLAKKLAFDKGISLDNIK
GTGINGRIIKKDIERYIDNNLDKTSNEVNEVNEVNEVNEVNEVNEVNEVNEVNEVNEVNE
VNHSNEVNEVNHSNIRKIISKRLINSKIESPHYSLFIEVIMDNLIKLRDSINEKKYLDKI
SFNDLIVKASALAIKENPKINSSWTEKSILYHNNINIGIAVALEDGLIVPVINQVNEKSL
RQISFEIKEKVIKAKEKKIQSNELEGSTFTVSNLGMFGIDSFTSIINQPNSCILSVGSIK
KKPIINNDKIVIGHTTKFTLTCDHRIIDGAVGSDYLKSLKKLLQEPLNIII
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagttatatttatgcctcgtctaagtgatactatggtagtaggtactgttgta
aaatggcataaaaagataggtgataaaattttagaaggagatattttagcggaaatagag
actgataaagcaattcaggaattggaagctgaatataattctacattgctttatattgga
atcaaagaaggagaaagtgccccagtaaatagtaatagtgtattagctattttaggttct
gaaaatgaagatattagttctttgctaaagcaaaatcaaattaattataaaagaattttt
atttctcctttagctaaaaaattagcttttgataaaggcatatcattagataatattaaa
ggtactggaattaatggacgaattataaaaaaagatatagaaagatatattgataataat
ttagataaaacatctaatgaagttaatgaagttaatgaagttaatgaagttaatgaagtt
aatgaagttaatgaagttaatgaagttaatgaagttaatgaagttaatgaagttaatgaa
gttaaccattctaatgaagttaatgaagttaaccattctaatattagaaaaataattagc
aaaagattaattaattctaaaattgaatcacctcattattctttatttatagaagtaatt
atggataatttaattaaattaagagactcgattaacgaaaaaaaatatttagataaaata
tcttttaatgatttaattgtgaaagcttcagctttagctataaaagaaaatccaaaaata
aattcttcttggacagaaaaaagtatattataccataataatataaatataggtatagca
gtagcattagaagatggtttaattgttcctgtaattaatcaggtaaatgaaaaatcttta
agacaaatttcttttgaaataaaagaaaaagtaataaaagctaaagaaaaaaaaattcaa
tctaatgaattagaaggtagtacttttactgtttcaaatcttggaatgtttggtatagat
tcatttacttctattataaatcaacctaattcttgtattttatctgtaggaagtattaaa
aaaaaacctattataaataatgataaaattgtaataggtcatactactaaatttacatta
acatgtgatcatagaattatagatggtgcagtaggtagtgattatttaaaaagtttaaaa
aaattattacaagagccattaaatataattatttaa

DBGET integrated database retrieval system