KEGG   Sinorhizobium meliloti Rm41: BN406_00165Help
Entry
BN406_00165       CDS       T02332                                 

Gene name
fadB
Definition
(GenBank) putative fatty oxidation complex alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
smi00071  Fatty acid degradation
smi00280  Valine, leucine and isoleucine degradation
smi00281  Geraniol degradation
smi00310  Lysine degradation
smi00362  Benzoate degradation
smi00380  Tryptophan metabolism
smi00410  beta-Alanine metabolism
smi00640  Propanoate metabolism
smi00650  Butanoate metabolism
smi00903  Limonene and pinene degradation
smi00930  Caprolactam degradation
smi01040  Biosynthesis of unsaturated fatty acids
smi01100  Metabolic pathways
smi01110  Biosynthesis of secondary metabolites
smi01120  Microbial metabolism in diverse environments
smi01130  Biosynthesis of antibiotics
smi01200  Carbon metabolism
smi01212  Fatty acid metabolism
Module
smi_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BN406_00165 (fadB)
   00650 Butanoate metabolism
    BN406_00165 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    BN406_00165 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    BN406_00165 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN406_00165 (fadB)
   00310 Lysine degradation
    BN406_00165 (fadB)
   00380 Tryptophan metabolism
    BN406_00165 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN406_00165 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BN406_00165 (fadB)
   00281 Geraniol degradation
    BN406_00165 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN406_00165 (fadB)
   00930 Caprolactam degradation
    BN406_00165 (fadB)
Enzymes [BR:smi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BN406_00165 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BN406_00165 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BN406_00165 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DAO NAD_binding_2 UDPG_MGDP_dh_N 2-Hacid_dh_C NAD_binding_8 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: CCM66210
Position
complement(174053..176266)
Genome map
AA seq 737 aa AA seqDB search
MSYTNFKIETDADGIALVTWDMPDKSMNVFTEEVMKELDAIIDQTTADPAVKGVVITSGK
SSFSGGADLSMIKSMFTFQAEEKKKDPDNAARKLFDLVGRMTGLFRKLETSGKPWVSAIN
GTCMGGAFEMSLACHGRVASNAKSVKIALPEVKVGIFPGAGGTQRVPRLTNTQDALQMMT
TGSSLTPARAKAMGLVHEVVDPDKLIEAAKAMIKNGLKPVQPWDEKGFKLPGGGIWTPAS
AQLWPAASGILRRETYGNYPGAIAILKCVYEGLQVPFDTALKIEQRYFTEILQTTEAFSM
IRSLFVSMQELGKGARRPAGVPKTELKKAGVVGAGFMGASIAYVTAAGGIPVTLVDRDME
AAEKGKTHSEGLVKDAIGKGRLTKEEGEALLSRITPSADYGDLRDAGLVIEAVFEDRQVK
KDVIEKVEAVIAEDAIFASNTSTLPITGLARNSKRPDRFIGIHFFSPVEKMMLTEVILGK
ETGDRALAAALDYVAAIRKTPIVVNDTRGFYVNRCVFRYIHEAYDMLIEGVPPAMIENAA
KMAGMPVGPLSLNDEVAIDLSQKILKAAVADLGDKAVDPRHMALIDKMVDELDRRGRKNG
KGFYEYPAKPARKYLWPGLKELYPQKDAGEIEVGVLKQRLLVTIALEAARTIEEGIVTDP
READVGSILGFGFAPYTGGTLSYIDGMGAKAFVELCEKLAADHGDHFRPTPLLKEMAEKG
ETFYGRFDPYGAGQKAA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacacaaacttcaagatcgaaaccgacgccgacggcattgcgctggtcacctgg
gacatgcccgacaagtcgatgaacgtcttcaccgaagaggtgatgaaggaactcgacgcc
attatcgatcagacgaccgcagatcctgccgtcaagggcgtggtcatcacctccggcaaa
tcctccttctccgggggtgccgacctttcgatgatcaagtcgatgttcaccttccaggcc
gaggaaaagaagaaggacccggacaacgcggcccggaaacttttcgacctcgtgggccgg
atgacgggtctcttccgcaagctcgaaacctcgggcaagccctgggtgtcggccatcaac
ggcacctgcatgggcggcgccttcgagatgtcgctcgcctgccacggccgtgtcgcctcc
aatgcaaaatcggtgaagatcgcgcttcccgaggtcaaggtcggcattttcccgggcgcc
ggcggcacccagcgcgttccgcggctgaccaatacgcaggacgcgctgcagatgatgacg
accggctcctcgctcacgccggcgcgggcaaaggccatggggctcgtccacgaggtggtc
gatccggacaagctgatcgaggctgccaaggcgatgatcaagaacggcctgaagccggtt
cagccctgggacgagaagggcttcaagctgccgggcggcggcatctggacgcccgcctcc
gcgcagctctggccggccgcctccggcatcctgcgccgcgagacctacggcaattacccc
ggcgcgatcgcgatcctgaaatgcgtctatgaggggctgcaggttcccttcgatacggct
ttgaagatcgagcagcgctatttcaccgaaatcctgcagacgaccgaagccttctcgatg
atccggtcgctgttcgtctcgatgcaggaactcggtaagggcgcgcgccggccggccggt
gtaccgaagaccgagctcaagaaagccggcgtcgtcggcgccggtttcatgggcgcctcg
atcgcctatgtaaccgcggcgggcggcatccccgtcaccctcgtcgaccgcgacatggaa
gctgccgaaaagggcaagacgcattcggaaggcctggtcaaggacgcgatcggtaaggga
cgcttgaccaaggaggaaggcgaagcgctgctttcgcgcatcacaccttcggcggactat
ggcgatctcagggatgccggcctcgtcatcgaggcggtcttcgaggaccggcaggtcaag
aaggacgtgatcgagaaggtcgaagcggtgatcgccgaggacgcgatcttcgcctccaac
acctcgacgctgccgatcaccggcctcgccaggaattccaaacgcccggaccggttcatc
ggcattcatttcttctcgccggtcgagaaaatgatgctgaccgaggtgatcctcggcaag
gagaccggagaccgtgcgctcgcggccgcgctcgactatgtcgcggcgatcaggaagacg
ccgatcgtcgtcaacgacacgcgcggcttctatgtcaatcgctgcgtcttccgctatatc
cacgaagcctatgacatgctgatcgagggcgtaccgccggcgatgatcgagaacgccgcc
aagatggccggcatgccggtcggaccgctgtcgctcaacgacgaggtggcgatcgacctc
agccagaagatcctgaaggcggccgttgccgatctcggcgacaaggccgtcgatcccagg
cacatggcgctgatcgacaagatggtcgacgagctcgaccggcgcggccgcaagaacggc
aagggcttctacgagtatccggcaaagccggccaggaaatatctctggccgggcctgaag
gagctctacccgcagaaggatgccggcgagatcgaggtcggtgtgctcaagcagcgcctg
ctcgtgacgatcgcactcgaagccgcgcgtacgatcgaggagggcatcgtcaccgacccg
cgcgaagccgatgtcggctcgatcctcggcttcggctttgcgccctacaccggcggcacg
ctctcctacatcgacggcatgggtgcgaaagcattcgtcgagctttgcgaaaagctcgcc
gcggaccatggcgaccacttccggccgacgccgcttttgaaggagatggcggaaaagggc
gaaaccttctacgggcgcttcgacccgtatggcgcggggcagaaggcggcataa

DBGET integrated database retrieval system