KEGG   Sinorhizobium meliloti Rm41: BN406_00166Help
Entry
BN406_00166       CDS       T02332                                 

Gene name
fadA
Definition
(GenBank) Putative acyltransferase Rv0859
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN406_00166 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    BN406_00166 (fadA)
   00640 Propanoate metabolism
    BN406_00166 (fadA)
   00650 Butanoate metabolism
    BN406_00166 (fadA)
  Lipid metabolism
   00071 Fatty acid degradation
    BN406_00166 (fadA)
   00072 Synthesis and degradation of ketone bodies
    BN406_00166 (fadA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN406_00166 (fadA)
   00310 Lysine degradation
    BN406_00166 (fadA)
   00380 Tryptophan metabolism
    BN406_00166 (fadA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN406_00166 (fadA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN406_00166 (fadA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BN406_00166 (fadA)
Enzymes [BR:smi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN406_00166 (fadA)
Exosome [BR:smi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN406_00166 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(176288..177496)
Genome map
AA seq 402 aa AA seqDB search
MTKVFVYDHVRTPRGRGKKDGALHEVPSVRLAAKVLEAVRDRNGLDTSTVDDVIMGCVDP
VMDAGAVIPKAAAFEAGYSTRAPGMQISRFCASGLDAVNFGAAKIAQGADDIVIAGGVES
MSRVGLGMSGGAWFMDPSVNLPAYFMPQGVSADLIATKYGFSRDDVDAYAVESQKRAANA
WEKGYFKNSVVPVKDQNGLVILDRDEHMRPGTDMQALASLNPSFQMPGEMGGFEAVGIQA
HPEIERINYVHHAGNSSGIVDGAAAVLIGSKAGGEAMGLKPRARIRAFANIGSDPALMLT
GPVDVTEKLLKRADMKLSDIDLFELNEAFAAVVLRYCQAFDIPHDKINVNGGAIAMGHPL
GATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagtcttcgtttacgaccacgtgcgcacgccgcgcggccgtggcaagaaggac
ggcgcgctgcacgaggtgccctccgtgcggctcgccgccaaggtgctcgaggccgtgcgc
gatcgcaacgggctcgacacttcgacggtcgacgacgtcatcatgggttgcgtcgacccg
gtcatggatgcgggtgcggtcatcccgaaagctgcagccttcgaggccggctattcgacg
cgtgcgcccggcatgcagatctcccgcttctgcgcctccggcctcgacgcggtcaatttc
ggcgctgcgaagatcgcccaaggagcggacgacatcgtgatcgccggcggcgtcgagtcg
atgtcccgcgtcggcctgggcatgtcgggcggcgcctggttcatggacccctcggtcaac
ctgcccgcctatttcatgccgcagggcgtttcggccgacctgatcgccacgaaatacggt
ttctcgcgcgacgacgtcgacgcctatgcggtggaaagccagaagcgcgccgccaatgcc
tgggagaagggctatttcaagaactcggtcgtcccggtcaaggaccagaacggcctggtc
attctcgaccgcgacgagcatatgcgccccggcaccgacatgcaggcactggcctcgctc
aacccttccttccagatgcccggcgagatgggcggcttcgaggccgtcggcatccaggcg
catccggagatcgagcgcataaactatgtccaccacgccggcaattcctccggcatcgtc
gatggcgccgctgccgtgctcatcggctccaaggccggcggcgaagccatggggctcaaa
ccccgcgcccgcatccgcgccttcgccaatatcggctccgacccggccctgatgctgacc
gggccggtcgacgtcaccgagaagctcctgaagcgggccgacatgaagctctccgacatc
gacctgttcgagctcaatgaggccttcgcggccgtcgtgctgcgctactgccaggctttc
gacatcccgcacgataagatcaacgtcaatggcggcgcgatcgccatgggccatccgctc
ggcgcgaccggggcgatgatcctcggcaccgtgctcgacgagctggagcgccgcgacctc
aacacggcgctggtgacgctctgcatcggcgccggcatgggcaccgccacgatcatcgaa
cgcgtctga

DBGET integrated database retrieval system