KEGG   Sinorhizobium meliloti Rm41: BN406_00214Help
Entry
BN406_00214       CDS       T02332                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase (Includes: pyrazinamidase, nicotinamidase) protein (EC:3.5.1.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BN406_00214 (pncA)
Enzymes [BR:smi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     BN406_00214 (pncA)
    3.5.1.-  
     BN406_00214 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
237231..237830
Genome map
AA seq 199 aa AA seqDB search
MADEALIVIDMQNDFCPGGALAVEGGDEIVPAVNRLIDASPHVVLTQDWHPAGHSSFAST
HPGKAPFQTVAMPYGEQTLWPEHCVQGSAGADFHPSLRWTSAELVIRKGFRREIDSYSAF
FENDHRTPTGLAGYLRERGIRSVTLCGLATDFCVAFSALDAVAKGFSTSVVLGACRGIDL
NGSLAAMTLRMRDAGVRLI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgaagccctgatcgttatcgatatgcagaacgacttctgccccggcggcgct
ctcgcggtcgagggcggcgatgaaatcgtacccgccgtcaatcgcctcatcgacgcgtcg
ccgcatgtcgtcctgacgcaggactggcacccggccggccattccagtttcgcctcgacg
catccgggcaaggctccgtttcagaccgtggcgatgccttacggagagcagacgctctgg
cccgagcattgcgtccaggggagcgccggtgccgattttcatccgtccctgcgatggacc
tcggcggagctcgtcatacgcaagggcttccgtcgcgagatcgacagttattccgccttt
ttcgaaaacgaccaccggaccccgaccgggcttgccggttacctgcgcgagcgcggcata
agaagcgtgacgctttgcggcctggctaccgatttctgcgttgccttctcggcactcgat
gcggtcgccaagggtttttcgacgtcggtggtgctcggcgcctgccgtggcatcgatctg
aacggctcgcttgcggccatgaccctgcgcatgcgcgatgccggcgtccggctgatctag

DBGET integrated database retrieval system