KEGG   Sinorhizobium meliloti Rm41: BN406_00226Help
Entry
BN406_00226       CDS       T02332                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:smi00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:smi00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
246550..247842
Genome map
AA seq 430 aa AA seqDB search
MDRIRIVGGNELHGVIPISGAKNAALPLMIASLLTDDTLTLENVPHLADVEQLIRILGNH
GADISVNGRRERQGESYARTVHFTSRNIVSTTAPYELVSKMRASFWVIGPLLAREGKARV
SLPGGCAIGTRPVDLFIEGLAALGANIEIDGGYVNATAPAGGLIGARYVFPKVSVGATHV
LMMAATLANGTTVLGNAAREPEVVDLAKCLNAMGAKISGQGTSTVTIEGVRSLSGARHRV
LPDRIETGTYAMAVAMAGGDVILEDTEASLLDTALEAIRRAGAEISETNSGIRIVRNGAG
IKPVDIVTDPFPGFPTDLQAQFMGLMTRSSGVSHITETIFENRFMHVQELARLGAKISLS
GQTAKVEGVSRLKGAPVMATDLRASVSLVIAGLAAEGETMVSRVYHLDRGFERLEEKLTR
CGAHVERVSD
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcatcaggattgtaggcggaaatgaactccacggggtgatccccatctccggc
gcgaagaacgccgccttgccgctgatgatcgcgtcgctcttgaccgacgacacgcttacg
ctcgaaaacgtcccgcatctggccgatgtcgagcaattgatccgcatcctcggcaatcat
ggtgccgacatttccgtcaatggccggcgcgagcgccagggcgagagctatgcccgcacg
gtccatttcaccagccgcaacatcgtttcgacgacggcgccttatgaactcgtctcgaag
atgcgcgcgagcttctgggttatcgggccgctgctcgcccgcgaaggcaaggcgcgggtg
tctctgccgggcggctgcgccatcggaacgcgtccggtcgacctcttcatagagggactg
gcagcactcggcgccaacatcgagatcgatggcggctacgtcaacgccacggcgccggca
ggcgggctcatcggtgcgcgctacgtgttcccgaaagtttccgtcggcgcgacgcatgtg
ctgatgatggcggcaacgcttgccaacggcacgaccgtgctcggcaatgccgcacgcgag
cccgaagtcgtcgacctcgccaaatgcctgaacgccatgggcgcgaagatcagcggccag
gggacgagcactgttacgatcgagggcgtgcgctcgctctcgggcgcccgtcaccgcgtg
ctgcccgaccgtatcgagacgggaacctatgcgatggcggtcgccatggcaggcggcgac
gtcattctcgaagacaccgaggcgagcctcctggacacggcgctggaggcgatccgccgt
gccggcgcggagatcagcgagacgaacagcggcatccgcatcgttcgcaacggcgccggc
atcaagccggtcgatatcgtcaccgatccgttccccggcttccccaccgacctccaggcg
cagttcatggggctgatgacccggtcgagcggggtttctcacattaccgagacgatcttc
gaaaaccgcttcatgcatgtgcaggaactggcgcggctcggcgccaagatctcgctttcc
ggccagacggcgaaagtcgagggcgtgtcgcggctgaagggcgcaccggtgatggcgacg
gatctcagggcctccgtctcgctcgtcatcgccggcctggcggcggagggcgagacaatg
gtctcgcgcgtctaccatctcgaccgcggcttcgaacgcctcgaagagaagctcacgcgc
tgcggcgcccatgtcgagcgcgtcagcgactga

DBGET integrated database retrieval system