KEGG   Sinorhizobium meliloti Rm41: BN406_00228Help
Entry
BN406_00228       CDS       T02332                                 

Gene name
hisD1
Definition
histidinol dehydrogenase 1 (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BN406_00228 (hisD1)
  Amino acid metabolism
   00340 Histidine metabolism
    BN406_00228 (hisD1)
Enzymes [BR:smi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BN406_00228 (hisD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
248501..249805
Genome map
AA seq 434 aa AA seqDB search
MAIRLNYLDTSFERDFAAFLTTKREVSEDVNAVVRAIIDDVRARGDAALADYSARFDGID
FTVTGMAVTSAEIDAAIHAVAPEVLGALKVAATRIEAHHRRQLPKDDIYEDQMGVGLGSR
WTPIDAVGLYVPGGTASYPSSVLMNALPAKVAGVPRIVMVVPASGGAINPAVLAAARLAG
VEEIYRIGGAQAVAALAYGTETIEPVAKIVGPGNAYVAAAKRQVFGTVGIDMIAGPSEVL
VIADRDNDPDWIAADLLAQAEHDAGAQAILITDDAAFGDAVEKAVERQLKTLPRAETAAA
SWRDFGAVILVPDFDKAVPLANRIAPEHLELATADPDAMVPAIRNAGAIFIGRHTPEVIG
DYVGGSNHVLPTARSARFSSGLGVLDYVKRTSILRLGPDQLRILGPAAIALARSEGLEAH
ARSVAIRLNLGEEG
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
ttggcaatcaggctgaactatctcgatacgagctttgagcgcgatttcgccgcgttcctg
acgaccaaacgggaagtttccgaagacgtcaacgccgtcgtgcgcgccatcatcgacgat
gtccgcgcccgcggagatgcggcgctcgccgactattccgcgcgtttcgacgggatcgac
tttactgtaaccggcatggcggtgacgtcggcggaaatagacgcggcgatccacgcggtc
gctccggaagtactcggcgcattgaaggtcgcggcgacccgcatcgaggcgcatcaccgg
cggcaattgccgaaggacgacatttacgaagaccagatgggcgtcggcctgggctcgcgc
tggacgccgatcgacgcagtcggtctctatgtgccgggcggcacggcgagctatccgagc
tcggttctgatgaacgccctgccggccaaggtcgcaggcgtgccgcgcatcgtcatggtc
gtgccggccagcggcggggctatcaatccggcggtgctcgcggctgcccgccttgccggc
gtcgaggagatctaccgcatcggcggcgcgcaggccgtggcggcgctcgcttacggcacc
gagacgatcgagccggtggcgaagatcgtcggccccggaaatgcctatgtcgcggccgcc
aagcggcaggttttcggcaccgtcggcatcgacatgatcgcggggccgtcggaagtgctg
gtgatcgcggaccgcgacaacgatccggattggatcgccgcggacctgctcgcccaggcc
gagcacgacgccggcgcgcaggcaatcctgatcaccgacgatgccgccttcggcgacgcg
gtcgaaaaggcggtggagcgtcagctgaagacgctgccgcgcgccgagacggcggcagcg
agctggcgcgatttcggcgccgtgatcctggttccggatttcgacaaggccgtgccgctc
gccaaccgcatcgccccggaacatctcgaactggcgaccgccgatccggacgcgatggtc
cccgcgatccgcaatgccggtgcgatcttcatcggcaggcacacacccgaagtcatcggc
gattatgtgggcggttccaaccacgtgctgccgacggcgcgttcggcgcggttctcctcc
ggcctcggcgtgctcgactatgtgaagcgaacttcgatcctgcggctcggcccggatcag
ttgcgcattctcgggcccgccgcgatcgcgctggcgagatcggaaggcctcgaggcccat
gcccggtcggtcgccatccgcctcaatctcggggaagagggatga

DBGET integrated database retrieval system