KEGG   Sinorhizobium meliloti Rm41: BN406_00577Help
Entry
BN406_00577       CDS       T02332                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BN406_00577 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BN406_00577 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BN406_00577 (thrC)
Enzymes [BR:smi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BN406_00577 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(603970..605370)
Genome map
AA seq 466 aa AA seqDB search
MVKYISTRGEAASLGFCDALLAGLARDGGLYLPKEWPALSKKEIRALRGKSYQEIAFTVL
EPFTNGEIPAAKFREMIDEAYATFRHPAVAPLVQTGPNAFVIELFHGSTLAFKDVAMQLL
ARLMDYVLAERGERATIVGATSGDTGGAAIDAFAGRDRTDIFILFPQGKVSPVQQRQMTT
STASNVHAVAVKGNFDDCQNLVKAMFNDQAFRDRVKLSGVNSINWARIMAQIVYYFTTAV
ALGAPDRKISFTVPTGNFGDIFAGYVAKRMGLPIDKLIIATNENDILARTLKNGRYEMRD
VKATTSPSMDIQISSNFERLIFEANERDPAEVRAAMASLRQSGSFTIGDAALKKIRKEFR
AGRASEKDVAKTIRKTFDETGYLLDPHTAIGVFVAAKHEKNSAPMVTLATAHPAKFPAAV
NSASGIDPALPTWLADLMTRAERFDILDPELKSVETFIGERTRVRE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagtatatttcgacacggggagaagcggcctctctcggcttttgcgatgctctt
ctggcgggacttgcccgcgacggcgggctttacctgccgaaggaatggccggcactctcg
aagaaggagatccgggcgctgcgcggcaaatcctatcaggagatcgccttcaccgttctc
gaacccttcaccaatggcgagatcccggcggccaagttccgcgagatgatcgacgaggcc
tatgccactttccgtcatccggccgtagcacccctggtccagaccggaccgaacgctttc
gtgatagagctctttcacggttcgacgctcgccttcaaggacgtcgccatgcagttgctc
gcccggctgatggactatgttcttgccgaacggggcgagcgggcgacgatcgtgggagcg
acatcaggcgataccggcggtgccgcgatcgacgccttcgccggccgcgaccgcaccgac
atcttcatcctctttccgcagggcaaagtgtcgccggtgcagcaaagacagatgaccacg
tccacggcatcgaacgtgcacgcggttgccgtcaaaggcaatttcgacgactgccagaac
ctggtcaaagccatgttcaacgaccaggccttccgcgaccgcgtgaagctttccggcgtc
aattcgatcaactgggcgcgcatcatggcccagatcgtctactatttcacgacggcggtc
gctctcggcgcgcccgaccggaagatctccttcaccgtgcctaccggcaatttcggcgat
attttcgcaggctacgtcgccaagcgcatgggtctgccgatcgacaagctgatcatcgcc
accaacgaaaacgacattctggcgcgcacgctgaagaacggccgctacgagatgcgcgac
gtcaaggcgacgacctcgccttcgatggacatccagatctcgtcgaacttcgaaaggctc
atcttcgaggcgaacgagcgcgatccggcggaagtccgcgcggccatggcgagcctcagg
caatccggctcgttcacgatcggcgacgcagcgctgaaaaaaatccgcaaggaatttcgc
gccggccgcgcctcggagaaagatgtggcgaaaacgatccgcaagaccttcgacgagacc
ggctatctccttgatccgcatacggcaatcggcgttttcgtggcagccaagcacgagaag
aactccgccccgatggtcacccttgcgactgcccatccggcaaaatttcccgccgcagta
aattcggcaagtggtattgaccccgcgcttccgacgtggcttgctgatctcatgactagg
gcggagcgtttcgacatcctggatccggagctcaagagcgtcgaaaccttcatcggcgag
cgtacccgcgttcgggaatag

DBGET integrated database retrieval system