KEGG   Sinorhizobium meliloti Rm41: BN406_00891Help
Entry
BN406_00891       CDS       T02332                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BN406_00891
   00240 Pyrimidine metabolism
    BN406_00891
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BN406_00891
   03430 Mismatch repair
    BN406_00891
   03440 Homologous recombination
    BN406_00891
Enzymes [BR:smi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BN406_00891
DNA replication proteins [BR:smi03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     BN406_00891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
902951..903400
Genome map
AA seq 149 aa AA seqDB search
MTEILFYHLTESKLEDALPPLLDKSIERGWRVVVQTIDAERRDALDTHLWVYRDDSFLPH
GTDAGEFAAEQPILVVADDGNRNAATVRFVVDGAEPPPVSEYERVVFMFDGYDQQQLEAA
RDQWKRLKGEGHNLTYWQQNRDGRWEKKA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagatccttttttaccacctgacggaatcgaagctcgaagacgccctgccgccg
ctgctcgacaagagcatagagcgcggctggcgggtggtcgtgcagacgatagacgccgaa
aggcgcgatgcactggatacgcatctatgggtctatcgggacgacagcttcctgccgcac
ggtacggacgccggcgagttcgcggcggagcaaccgattctcgtcgttgccgatgacggc
aaccggaatgccgcgactgtgcgctttgtcgtcgacggcgccgagccgccgccggtttcc
gaatatgagcgggttgttttcatgttcgacggctacgaccagcaacagctcgaggcggcg
cgcgatcagtggaagcggctcaagggcgaggggcacaatctcacctattggcagcagaac
cgtgacggaaggtgggaaaagaaggcgtga

DBGET integrated database retrieval system