KEGG   Sinorhizobium meliloti Rm41: BN406_01256Help
Entry
BN406_01256       CDS       T02332                                 

Definition
hydrolase glycosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BN406_01256
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BN406_01256
Enzymes [BR:smi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BN406_01256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1288413..1289447
Genome map
AA seq 344 aa AA seqDB search
MQYAFRMSESKAFISGCKGLTLTQEERDFFAGERPWGFILFGRNIGEEEQIRDLVASLRE
SIGSPQAPVLIDQEGGRVQRIRPPLVQQYPNGAAIGEIYRRDRELGLRAAWLMGRLHAFD
LMRFGITVDCLPVLDVPVPGTHDVIGNRAYGHDPATVTAIGRAMSEGLKAGGMLPVMKHM
PGHGRTFVDSHHNLPVVSAGLDELKSSDFLPFAAMKDEAMAMSAHMVFTAIDPDNPATTS
AKVVREIIRGHIGFDGLLMSDDVSMNALAGDMTARAGGIIAAGLDLVLHCHGIMEEMKAV
ADVVPVLSGERLRRARAAEAAFREPDDAVEAALRAEFNAMFALA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatgcttttcgcatgagcgaatcaaaagcattcatatccggctgcaagggcctc
acgctgacgcaggaagaacgcgacttctttgcgggcgagcgcccatggggcttcattctc
ttcggacgcaatatcggcgaggaagagcagatccgcgacctggtggcgagcctgcgtgag
agcatcggcagcccccaggccccggtattgatcgatcaggagggcggtcgcgttcagcgc
atacgcccgccgctcgtgcagcaatatccgaacggcgcggcgatcggcgaaatctatcgg
cgggacagggaactcggcctgcgtgccgcatggctcatggggcgcctgcatgccttcgac
ctgatgcgcttcggcattacggtcgattgcctgccggtactcgatgtgccggtacccggc
acccatgacgtgatcggcaatcgtgcctacgggcatgacccggcgacggtaaccgcgatc
ggtcgcgcgatgagcgaaggtttgaaggcgggcggcatgctgccggtgatgaagcacatg
cccggtcacggccggaccttcgtcgactcgcatcacaacctgccggtcgtcagcgccggt
ctcgatgagttgaagagcagcgattttctgcccttcgcggcaatgaaggacgaagcgatg
gccatgtcggcgcacatggtcttcactgctatcgacccggacaacccggcgacgacctct
gcgaaagtcgtgcgcgagatcatccggggccacatcggcttcgacggtctgctgatgtcc
gatgacgtctccatgaatgcgcttgccggcgacatgacggcacgtgccggcggaataatc
gccgccggtcttgatctcgtcttgcattgtcacggcattatggaagaaatgaaggccgtg
gcagatgtcgttccggttctctccggggagaggctccgccgggcgagggctgccgaggcc
gctttccgggaaccggacgacgcagtcgaagctgcactgcgcgcggagttcaacgcaatg
tttgcgctcgcctag

DBGET integrated database retrieval system