KEGG   Sinorhizobium meliloti Rm41: BN406_01265Help
Entry
BN406_01265       CDS       T02332                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
smi  Sinorhizobium meliloti Rm41
Brite
Enzymes [BR:smi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BN406_01265 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1296360..1296974
Genome map
AA seq 204 aa AA seqDB search
MALRLRSGGIVNHELLKAVEQTPRTLFAPPQYQDEVYSKRLIPLDCGSFMEGCDMAVRLL
HCLNLKPGQRILEVGTGSGFTAAVMGRIAERVLTIERYQTLVASAQKNLEKAGLRNVVVR
QADGSAGVPGEGTFDRILITAAFNSLPRTFSDHLVSGGTLLVPIMMSETHCRIVRVNRTG
SRFDREDLFDAPYLPIVPQVASFL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcggcttcgctcgggcggcatcgtcaatcatgaactgctgaaggctgtggag
cagacgccgcggacgctcttcgctccgccgcaataccaggacgaggtctactccaaacgg
ctgatcccgctcgattgcggctccttcatggagggctgcgacatggccgtccggctcctg
cattgtctcaatctcaagcctggccagcgcatactcgaggtcggaaccggcagcggcttt
accgcggccgtgatggggcggatcgccgaacgcgtgctgacgatcgagcggtatcagaca
ctcgtcgcatcggcgcagaaaaacctggagaaggcgggcctgcgcaacgtcgtcgtgcgc
caggccgatggcagcgcaggagtgccgggtgagggcaccttcgaccggatcctcataacc
gccgcgttcaacagccttccccggacgttctccgatcatctcgtctccggcggcaccctg
ctggtgccgatcatgatgagcgaaacgcattgccgcatcgttcgcgtcaaccgcaccggt
agccgcttcgaccgggaagatctgttcgacgcgccttacctcccgatcgtcccacaggta
gcgtcgttcctttaa

DBGET integrated database retrieval system