KEGG   Sinorhizobium meliloti Rm41: BN406_01413Help
Entry
BN406_01413       CDS       T02332                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
smi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
smi01100  Metabolic pathways
smi01110  Biosynthesis of secondary metabolites
smi01130  Biosynthesis of antibiotics
smi01230  Biosynthesis of amino acids
Module
smi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BN406_01413 (trpC)
Enzymes [BR:smi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BN406_01413 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: CCM67458
Position
1455992..1456807
Genome map
AA seq 271 aa AA seqDB search
MTDILRRIEAYKREEIAAAKARVPLEELKARAADQSAPRGFHAALAARRDKGEFGLIAEI
KKASPSKGLIRPDFDPPELAKAYAAGGAACLSVLTDAPSFQGAPEFLTKAREACPLPALR
KDFMFDTYQVFEARAWGADCILLIMASLGDNDARRLEEAAFALGMDVLVEVHDAEEMERA
LRLSSPLVGINNRNLRTFEVDLAVSERLAAMVSADRLLVGESGVFTHEDCRRLEKSGITT
FLVGESLMRKDDVEAATRALLTGSASIMAAE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgacggatatcctgcgccgcatcgaagcctataagcgagaggagatcgccgccgcgaaa
gcgcgcgttccgctcgaagagttgaaggcgcgggccgccgatcagtccgcgccgcgcggt
ttccacgccgcgcttgcggcccggcgggacaaaggcgagttcgggctgatcgccgaaatc
aagaaggcgagcccctcgaagggtttgatccgcccggatttcgatcctccggaactggcg
aaggcctatgccgcgggcggcgccgcctgcctctccgtccttaccgacgcgccgagcttc
cagggtgcgccggagttcctgacgaaggcacgcgaggcctgcccgctcccggctctgcgc
aaggacttcatgttcgacacctatcaggttttcgaagcgcgcgcctggggcgccgattgc
attctgctgatcatggcctcgcttggcgacaatgatgcgcgccggctggaagaagccgca
tttgcactcggcatggatgtcctcgtcgaagtacacgacgcggaagagatggaacgagca
cttcgcctgtcatctccgctcgtcgggatcaacaaccgcaatctcaggacgttcgaggtc
gatctcgccgtctccgaaaggctcgcggcaatggtttccgcagaccgtctcctggtcggc
gaaagcggcgtattcacgcacgaagactgccggcgcctagagaagagcgggattaccacc
ttcctggtcggtgaaagcctgatgaggaaggacgacgtagaggcggcgacgcgtgcgctg
ctgaccggctcggcaagcatcatggcggcagagtga

DBGET integrated database retrieval system