KEGG   Sinorhizobium meliloti Rm41: BN406_01949Help
Entry
BN406_01949       CDS       T02332                                 

Gene name
gst6
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
smi00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BN406_01949 (gst6)
Enzymes [BR:smi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BN406_01949 (gst6)
Transporters [BR:smi02000]
 Other Transporters
  Pores ion channels [TC:1]
   BN406_01949 (gst6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3 AEP1
Motif
Other DBs
NCBI-ProteinID: CCM67994
Position
complement(1977019..1977624)
Genome map
AA seq 201 aa AA seqDB search
MLTLIHAPLSRSSRIIWLLEELGAEYEIRYVDIRRWDGSGGPDENNPHPHKQVPALLHDG
TLIWESVAVVQYLTDLYPDCSLSRPPGHPERGAYLSWLAYYAGVIEPTALAHISGVTVNN
PGLARLYTEMCAHVIDALTRHTYLLGESMSAADLLLASALQWMRKILPESDVIDRYIRVV
TDRAALVRAREIDNKPSGFHD
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgctgatccacgcgcctttgtcgcgctcatcgcgcatcatctggctgctcgaa
gagctcggtgccgaatacgagatccgctatgtcgatatccgccgttgggacggatcgggc
ggcccggacgagaacaatccgcatccgcacaagcaggtgccggcactcctccacgacggg
acattgatctgggagtcggtcgcggtcgtgcaatatctgacggatctctatcccgattgc
agcctgagccggccgccgggccatcccgagcgcggcgcctatctgtcgtggctcgcctac
tatgccggtgtcatcgagccgaccgctctcgctcatatatccggagtgacggtgaacaat
ccggggctcgcgaggctttacaccgaaatgtgtgcgcatgtgatcgacgcgcttacgcgg
cacacctatctccttggtgaatcgatgagcgccgccgatctgttgcttgcaagcgcattg
cagtggatgcgcaagatcctgccggaaagcgacgtgatagatcgctatattcgcgtcgtc
acggaccgggcggcgctggttcgcgcgcgcgaaatcgacaacaagccgagtggttttcat
gactga

DBGET integrated database retrieval system