KEGG   Sinorhizobium meliloti Rm41: BN406_02057Help
Entry
BN406_02057       CDS       T02332                                 

Gene name
fucA1
Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BN406_02057 (fucA1)
Enzymes [BR:smi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BN406_02057 (fucA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2099241..2099909)
Genome map
AA seq 222 aa AA seqDB search
MNELQLRQSIIDHCRHMNAIGLNQGTSGNISLRHGGTMLITPSAIPYAEMTPDMIVAMPI
EGEYGAWVGPKKPSVEWPFHLDILRARPDVGAVVHTHASFSTILAMARKPIPACHYMIAA
FGGSDVRVADYARYGTKALSENVLKAMEGRSACLMANHGMIATGSSLEKAMWAAVELETI
AKQYYHVLLIGGPVVLPQEEIAGVIEGFATYGHQDKPKGEAA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacttcaactgcgccagtcgatcatcgaccattgccgccacatgaatgcgatc
ggcctcaaccagggcacttcgggcaatatcagcctgcgccacggcggcacgatgctgatc
accccgtctgcgatcccctatgccgagatgacgccggacatgatcgtcgccatgccgatc
gagggcgagtatggcgcctgggtagggccgaagaagccctcggtcgaatggcccttccac
ctcgacattctgcgggcgcggccggatgtcggcgccgtcgttcatacccacgcgagcttc
tcgacgatcctcgcgatggcgcgcaagccgattcccgcctgtcactacatgatcgccgcc
ttcggcggttccgacgtgcgcgtcgccgattacgcccgctacggcacgaaggcgctgtcg
gaaaacgtgctgaaggcgatggaggggcgttccgcctgcctcatggccaatcacggcatg
atcgcgaccggttcgagcctggaaaaggcgatgtgggcggcggtcgagctcgagacgatc
gccaagcaatattaccacgtgctcctgatcggcggtccggtggtcctgccgcaggaggaa
atcgccggcgtcatcgagggatttgccacttacggccatcaggacaaacccaagggcgag
gccgcctga

DBGET integrated database retrieval system