KEGG   Sinorhizobium meliloti Rm41: BN406_02607Help
Entry
BN406_02607       CDS       T02332                                 

Gene name
ruvA
Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:smi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2679181..2679798)
Genome map
AA seq 205 aa AA seqDB search
MIGKLKGTIDEIGEDHVVLDVHGVGYVAHCSARTLGKLGSAGEAAVLFIETYVREDQLKL
FGFLSALEREWFRLLQSVQGVGSKVALAVLSTLTPGELANAIALQDKTSISRAPGVGPKV
AVRIVTELKNKAPAFSGEMAPSIGLKQELGEGVAAAPVADAVSALTNLGYSRDQAANAVA
AALKNGGEGGDSAKLIRLGLKELSR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgattggcaagctcaagggcacgatagacgagatcggcgaggatcacgtggttctcgac
gtgcatggggtcgggtatgtcgcccattgctccgcgcgcacgctcggaaagctcggaagc
gctggagaggcggccgtactcttcatcgagacctatgtgcgcgaggatcagctgaagctg
ttcgggttcctgagcgcgttggagcgcgaatggttccgcctgcttcagagcgttcagggt
gtgggatccaaggtggcgctggcggtgctctccacgctgacccccggggaactcgccaat
gccatcgccttgcaggacaagacgtcgatctcgcgcgcgccgggcgtgggtccgaaagtt
gccgtgcgcatcgtcaccgaactcaagaacaaggctccggccttctccggcgagatggca
ccatcgatcggcctcaagcaggagctcggcgaaggcgttgccgcagcgccggttgcggac
gcggtctcggcgctcaccaatctcggctattcgcgagaccaggcggccaacgccgttgcg
gctgcgctgaaaaacggcggggagggcggcgacagcgccaagctgatccgcctcggcttg
aaggaactgtcgcggtga

DBGET integrated database retrieval system