KEGG   Sinorhizobium meliloti Rm41: BN406_02665Help
Entry
BN406_02665       CDS       T02332                                 

Gene name
exoN
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BN406_02665 (exoN)
   00052 Galactose metabolism
    BN406_02665 (exoN)
   00500 Starch and sucrose metabolism
    BN406_02665 (exoN)
   00520 Amino sugar and nucleotide sugar metabolism
    BN406_02665 (exoN)
Enzymes [BR:smi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BN406_02665 (exoN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2739960..2740847)
Genome map
AA seq 295 aa AA seqDB search
MTDKRKVRKAVFPVAGLGTRFLPATKAVPKEMLTVVDKPVIQYVVDEALEAGIEHLIFVT
GRSKAVIEDYFDIQVELDQTLRERNKKAEIELLEAMLPKAGTTSFTRQQAPLGLGHAVWC
ARDLVGNEPFALLLPDMIMKGEKGCLKGMVELYEESGGNVVAVEECAPDQAHKYGIVGVG
ETVGDGFRITRMVEKPAKGTAPSNFFINGRYILQPEIFPILETQERGAGNEIQLTDGMVK
LAEAQPFAAYHFRGDTYDCGAKDGFILANVAFALERGDIRPIVEGPLKTLLQGLK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaagcgcaaagtccgcaaagccgttttccccgttgcaggtctcgggacccgt
ttccttccggcgaccaaggcggttccgaaggagatgctgacggtggtggacaagccggtc
atccaatatgttgtcgatgaggcgctcgaagccggcatcgagcatctgattttcgtgacc
ggccgcagcaaggcggtcatcgaggactatttcgacatccaggtcgaattggaccagacg
ctgcgcgagcgcaacaaaaaggcggagatcgagctcctcgaagccatgctgccgaaggcc
ggcaccacgagcttcacccgccagcaggcacccctgggcctcggccatgccgtctggtgc
gcccgcgatctcgtcggcaatgagcccttcgctctgctcctgcccgatatgatcatgaag
ggcgagaagggttgcctcaagggcatggtcgagctctacgaagagtccggcggcaacgtc
gtcgcggtggaggaatgcgcgcccgaccaggcgcataaatacgggatcgtcggagtgggc
gagacggtcggcgacggtttcaggatcaccaggatggtcgagaagccggccaaggggacg
gctccgtcgaacttcttcatcaatggccgctacatcctgcagccggagattttcccgatc
ctggaaacgcaggaacgcggcgccggcaacgagatccagctgaccgacggcatggtgaag
cttgccgaggcccagcccttcgccgcctatcacttccgcggcgatacgtatgactgcggc
gccaaggacggcttcatcctggcgaacgtcgccttcgctctcgagcgcggcgatatccgc
cccatcgtggaaggaccgttgaagacgctcctgcagggtcttaagtaa

DBGET integrated database retrieval system