KEGG   Sinorhizobium meliloti Rm41: BN406_02680Help
Entry
BN406_02680       CDS       T02332                                 

Gene name
pldB
Definition
lysophospholipase L2 protein (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:smi00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2762055..2763002
Genome map
AA seq 315 aa AA seqDB search
MPGDPVVGFFDGARNRKIRYAVFRSKAPVIRGTIVLLQGRNESIEKYFETIGDLMAAGFW
VATFDWRGQGGSERLSPQWTHGHVEDFTDYERDLTIFLDEIVLPDTRLPFSIVAHSMGAL
VALSLAPMLASRIDRMVLLAPFVGLGGQAIGERGIAAIATVMRWIGLGRLALSSDKGNGT
PFRGNVLTADDRRYARNLALIDARPQLRVGPPTARWLSEAFRTIRRVLKHEHLTRITIPA
VILAPTADKLVPYLPVERLASNFRAGHLIPIDGARHELLQEADRYRAQAMAAILAFLPGA
DAEDPASLPRQLEEA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgccgggcgatccggtggttggctttttcgacggagcccgcaaccgcaagatccgctac
gcggtgttcaggtcgaaggccccggtcattcgcggcaccatcgtcctgctgcagggtcgc
aacgagtcgatcgagaaatacttcgaaacgatcggcgatctcatggcggccggtttctgg
gtcgcgaccttcgactggcgcggacagggcggctccgagcggctgtcgccgcaatggacc
cacggccatgtggaggatttcaccgattacgagcgcgacctgacgatttttctcgatgag
atcgtccttcccgacacccgcctgcccttctcgatcgtcgcccattcgatgggggcgctc
gtcgccctgtcgctcgctcccatgctcgcaagccgcatcgaccggatggtgctgcttgcc
cccttcgtcggtctggggggccaggcgatcggcgaacggggtatcgcagcgatcgcgacg
gtcatgcgctggatcggcctcgggaggctggcgctgagttccgacaaaggcaacggtacc
ccttttaggggcaatgttctgaccgcggacgaccggcgctacgcccgcaacctggcgctc
atcgatgcgcgtccgcaactgcgggtcggaccgcccacggcccgctggctgagcgaggcc
ttccgaacgatccggcgcgtcctcaagcacgaacatctgacgaggatcaccataccggcc
gtcatactcgccccgacggccgataagctcgtgccgtatctcccggtcgagcggttggcc
agcaatttccgtgcggggcatctgatcccgatcgacggcgcgcggcacgaactcctgcag
gaggccgaccgctatcgcgcccaggcgatggccgcgatcctggcctttctgccgggcgcc
gatgcggaggaccccgcgtccctgccgcgacagttggaagaggcttaa

DBGET integrated database retrieval system