KEGG   Sinorhizobium meliloti Rm41: BN406_02700Help
Entry
BN406_02700       CDS       T02332                                 

Gene name
glgB
Definition
(GenBank) 1,4-alpha-glucan branching enzyme GlgB
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
smi00500  Starch and sucrose metabolism
smi01100  Metabolic pathways
smi01110  Biosynthesis of secondary metabolites
Module
smi_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BN406_02700 (glgB)
Enzymes [BR:smi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BN406_02700 (glgB)
Exosome [BR:smi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN406_02700 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: CCM68745
Position
2784962..2787172
Genome map
AA seq 736 aa AA seqDB search
MTVPPGKDPAPAPLGMLPAPEIAAILSGTHSNPFAVLGVHAAGKTYVARCFVPGAETVIA
ETLSGKELGTLERRDEAGFFEGPVALRKEQPIRYRARNDGGEWTVIDPYSFGPVLGPMDD
YYIREGSHLRLFDKMGAHPIRHDGAEGFHFAVWAPNARRVSVVGSFNDWDGRRHVMRLRV
DTGIWEIFIPGVPVGTPYKYEIVDSNGTLLPLKADPFARRSELRPDTASMTADEIAQNWE
DEAHRRHWAEIDPRRQPISIYEVHAASWQRRDNGDMLTWDELAERLIPYCVDMGFTHIEF
LPISEYPYDPSWGYQTTGLYAPTARFGEPEGFARFVNGCHKVGIGVILDWVPAHFPTDEH
GLRWFDGTALYEHADPRQGFHPDWNTAIYNFGRQEVVAFLVNNALYWAEKFHVDGLRVDA
VASMLYLDYSRKHGEWVPNEYGGNENLEAVRFLQTMNTRIYGIHQGVLTIAEESTSWPKV
SHPVHAGGLGFGFKWNMGFMHDTLQYLSREPVHRKFHHNDMTFGLLYAFSENFVLPLSHD
EVVHGKGSLIAKMAGDDWQKFANLRAYYGFMWGYPGKKLLFMGQEFAQWREWSEDRGLDW
NLLEYNLHEGMRRLVRDLNGTYRSKPALHARDCEGDGFEWLIADDRENSVFAWLRKAPGE
KLVAVVTNFTPVYREHYDIPLPVAGRWKEVLNTDAEIYGGSGKGNGGAVHAEKRANGETI
ATITLPPLATLMLEQD
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgacggttccgcccggcaaggatccagcccccgccccgctaggcatgctgccagcgccg
gaaatcgcggcaatactttccggtacccacagcaaccccttcgccgtccttggagtgcat
gccgcgggcaagacctatgtcgcccggtgcttcgtgccgggtgcggaaacggtgattgcc
gaaacgctcagcggcaaggaactcggcacgctcgagcggcgcgacgaggccggcttcttc
gagggtccggtggcgctccgcaaagagcagcccatccgctaccgcgcccgcaacgacggc
ggcgagtggaccgtcatcgatccctacagcttcggccccgtgctcgggccgatggacgac
tactatatccgcgagggctcgcaccttcgcctcttcgacaagatgggcgcgcatccgatc
cggcatgacggcgccgagggttttcacttcgccgtctgggcgccgaacgcccgccgtgtg
tccgtggtcgggagtttcaacgactgggacggacgccggcatgtcatgcgcctgcgtgtc
gacaccggtatctgggagatcttcatccccggcgtgcccgtgggtacgccctataaatac
gaaatcgtcgacagcaacggcacgctgctgccgttgaaggccgacccctttgcccggcgc
tcggagctcaggcccgacaccgcttcgatgaccgcggacgagatcgcccagaactgggag
gacgaggcgcatcggcgtcactgggccgagatcgatccgcgccggcagccgatctcgatc
tacgaggtccatgcggcctcatggcagcgccgcgacaatggcgacatgctcacctgggac
gaactggcggaaaggctgatcccctattgcgtcgatatgggcttcacgcacatcgagttc
ctgcccatttcggaatatccctatgatccgtcctggggctatcagaccaccggcctctat
gcgccgaccgcacgcttcggcgagccagagggctttgcccgtttcgtcaacggctgccat
aaggtgggcatcggcgtcatcctcgactgggtgccggcgcattttccgaccgacgaacac
gggcttcgctggttcgacggcaccgcgctttacgagcatgcggatccgcgccaggggttc
catcccgactggaacacggcgatctacaatttcggccgtcaggaggtcgtcgcctttctg
gtcaacaacgctctctactgggcggagaaattccatgtcgacggcctgcgcgtcgatgcg
gtcgcctcgatgctctatctcgactattcgcgcaagcatggcgaatgggtgccgaacgaa
tatggcggcaacgaaaatctcgaggccgtgcgtttcctgcagacgatgaacacccgcatc
tacggcatccaccagggcgtgctgaccatcgccgaggaatcgacgtcctggccgaaggtc
tcgcacccggtgcatgccggcgggctcggcttcggcttcaagtggaacatgggcttcatg
cacgacacgctgcaatatctctcgcgcgagcccgtgcaccgaaagttccaccacaacgat
atgaccttcgggctgctctacgccttcagcgagaatttcgtgctgccgctgtcccatgac
gaggtcgtccacggcaaggggtcgctgatcgccaagatggccggcgacgactggcagaag
ttcgccaatctccgcgcctattacggcttcatgtggggctatcccggcaagaagctcctt
ttcatgggacaggaattcgcccaatggcgcgaatggtcggaggaccgcggtctcgactgg
aacctgctcgaatacaatctgcatgaggggatgcgccgtctggtgcgcgacctgaacggc
acctatcgctcgaagccggcgctgcatgcgcgcgactgcgagggcgacggtttcgaatgg
ctgattgccgacgatcgtgagaattccgtcttcgcctggctgaggaaagcgcccggagag
aagctggtcgcggtcgtcaccaacttcactccggtttaccgggagcattacgacataccg
cttccggtggcagggcgctggaaggaagtcctcaataccgacgcggaaatctatggagga
agtggcaagggcaacggcggcgccgtccatgcagagaagagagcgaacggagagacgatc
gccaccatcacgctgccgcctctggcgacgctgatgctggagcaggattag

DBGET integrated database retrieval system