KEGG   Sinorhizobium meliloti Rm41: BN406_02700Help
Entry
BN406_02700       CDS       T02332                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme GlgB (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:smi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2784962..2787172
Genome map
AA seq 736 aa AA seqDB search
MTVPPGKDPAPAPLGMLPAPEIAAILSGTHSNPFAVLGVHAAGKTYVARCFVPGAETVIA
ETLSGKELGTLERRDEAGFFEGPVALRKEQPIRYRARNDGGEWTVIDPYSFGPVLGPMDD
YYIREGSHLRLFDKMGAHPIRHDGAEGFHFAVWAPNARRVSVVGSFNDWDGRRHVMRLRV
DTGIWEIFIPGVPVGTPYKYEIVDSNGTLLPLKADPFARRSELRPDTASMTADEIAQNWE
DEAHRRHWAEIDPRRQPISIYEVHAASWQRRDNGDMLTWDELAERLIPYCVDMGFTHIEF
LPISEYPYDPSWGYQTTGLYAPTARFGEPEGFARFVNGCHKVGIGVILDWVPAHFPTDEH
GLRWFDGTALYEHADPRQGFHPDWNTAIYNFGRQEVVAFLVNNALYWAEKFHVDGLRVDA
VASMLYLDYSRKHGEWVPNEYGGNENLEAVRFLQTMNTRIYGIHQGVLTIAEESTSWPKV
SHPVHAGGLGFGFKWNMGFMHDTLQYLSREPVHRKFHHNDMTFGLLYAFSENFVLPLSHD
EVVHGKGSLIAKMAGDDWQKFANLRAYYGFMWGYPGKKLLFMGQEFAQWREWSEDRGLDW
NLLEYNLHEGMRRLVRDLNGTYRSKPALHARDCEGDGFEWLIADDRENSVFAWLRKAPGE
KLVAVVTNFTPVYREHYDIPLPVAGRWKEVLNTDAEIYGGSGKGNGGAVHAEKRANGETI
ATITLPPLATLMLEQD
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgacggttccgcccggcaaggatccagcccccgccccgctaggcatgctgccagcgccg
gaaatcgcggcaatactttccggtacccacagcaaccccttcgccgtccttggagtgcat
gccgcgggcaagacctatgtcgcccggtgcttcgtgccgggtgcggaaacggtgattgcc
gaaacgctcagcggcaaggaactcggcacgctcgagcggcgcgacgaggccggcttcttc
gagggtccggtggcgctccgcaaagagcagcccatccgctaccgcgcccgcaacgacggc
ggcgagtggaccgtcatcgatccctacagcttcggccccgtgctcgggccgatggacgac
tactatatccgcgagggctcgcaccttcgcctcttcgacaagatgggcgcgcatccgatc
cggcatgacggcgccgagggttttcacttcgccgtctgggcgccgaacgcccgccgtgtg
tccgtggtcgggagtttcaacgactgggacggacgccggcatgtcatgcgcctgcgtgtc
gacaccggtatctgggagatcttcatccccggcgtgcccgtgggtacgccctataaatac
gaaatcgtcgacagcaacggcacgctgctgccgttgaaggccgacccctttgcccggcgc
tcggagctcaggcccgacaccgcttcgatgaccgcggacgagatcgcccagaactgggag
gacgaggcgcatcggcgtcactgggccgagatcgatccgcgccggcagccgatctcgatc
tacgaggtccatgcggcctcatggcagcgccgcgacaatggcgacatgctcacctgggac
gaactggcggaaaggctgatcccctattgcgtcgatatgggcttcacgcacatcgagttc
ctgcccatttcggaatatccctatgatccgtcctggggctatcagaccaccggcctctat
gcgccgaccgcacgcttcggcgagccagagggctttgcccgtttcgtcaacggctgccat
aaggtgggcatcggcgtcatcctcgactgggtgccggcgcattttccgaccgacgaacac
gggcttcgctggttcgacggcaccgcgctttacgagcatgcggatccgcgccaggggttc
catcccgactggaacacggcgatctacaatttcggccgtcaggaggtcgtcgcctttctg
gtcaacaacgctctctactgggcggagaaattccatgtcgacggcctgcgcgtcgatgcg
gtcgcctcgatgctctatctcgactattcgcgcaagcatggcgaatgggtgccgaacgaa
tatggcggcaacgaaaatctcgaggccgtgcgtttcctgcagacgatgaacacccgcatc
tacggcatccaccagggcgtgctgaccatcgccgaggaatcgacgtcctggccgaaggtc
tcgcacccggtgcatgccggcgggctcggcttcggcttcaagtggaacatgggcttcatg
cacgacacgctgcaatatctctcgcgcgagcccgtgcaccgaaagttccaccacaacgat
atgaccttcgggctgctctacgccttcagcgagaatttcgtgctgccgctgtcccatgac
gaggtcgtccacggcaaggggtcgctgatcgccaagatggccggcgacgactggcagaag
ttcgccaatctccgcgcctattacggcttcatgtggggctatcccggcaagaagctcctt
ttcatgggacaggaattcgcccaatggcgcgaatggtcggaggaccgcggtctcgactgg
aacctgctcgaatacaatctgcatgaggggatgcgccgtctggtgcgcgacctgaacggc
acctatcgctcgaagccggcgctgcatgcgcgcgactgcgagggcgacggtttcgaatgg
ctgattgccgacgatcgtgagaattccgtcttcgcctggctgaggaaagcgcccggagag
aagctggtcgcggtcgtcaccaacttcactccggtttaccgggagcattacgacataccg
cttccggtggcagggcgctggaaggaagtcctcaataccgacgcggaaatctatggagga
agtggcaagggcaacggcggcgccgtccatgcagagaagagagcgaacggagagacgatc
gccaccatcacgctgccgcctctggcgacgctgatgctggagcaggattag

DBGET integrated database retrieval system