KEGG   Sinorhizobium meliloti Rm41: BN406_02927Help
Entry
BN406_02927       CDS       T02332                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase membrane anchor subunit protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
smi00020  Citrate cycle (TCA cycle)
smi00190  Oxidative phosphorylation
smi00650  Butanoate metabolism
smi01100  Metabolic pathways
smi01110  Biosynthesis of secondary metabolites
smi01120  Microbial metabolism in diverse environments
smi01130  Biosynthesis of antibiotics
smi01200  Carbon metabolism
Module
smi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
smi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
smi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN406_02927 (sdhD)
   00650 Butanoate metabolism
    BN406_02927 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    BN406_02927 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: CCM68972
Position
complement(3049991..3050371)
Genome map
AA seq 126 aa AA seqDB search
MNMRTPLGKVRGLGSAKEGTDHFWRQRLTAVASIPLTIFFVVFLAHYAGAPHAELIAALS
NPFVAVTMGLMVVAGLVHMKIGMQVIIEDYVHGEGAKIALLMLNTFFTIAVGGLCLFAVL
KIAFAG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgcgcacacctctcggcaaggtccggggtctcggttcggcaaaggaaggcacg
gatcacttctggcggcagcgcctcacggccgtcgccagcattcctctcacgatcttcttc
gtcgtctttctcgcccattatgcgggcgcaccgcatgcggaactgatcgcggccctttcg
aacccgttcgtggcggtgaccatgggtctgatggtcgtcgccggcctcgttcacatgaag
atcggcatgcaggtcatcatcgaggactacgtccatggggagggcgccaagatagcgctt
ctcatgctcaacacattcttcacgatcgcggtcggcgggctctgtcttttcgccgtcctg
aagatcgcatttgcagggtaa

DBGET integrated database retrieval system