KEGG   Sinorhizobium meliloti Rm41: BN406_02958Help
Entry
BN406_02958       CDS       T02332                                 

Gene name
proB1
Definition
glutamate 5-kinase 1 (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BN406_02958 (proB1)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BN406_02958 (proB1)
Enzymes [BR:smi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BN406_02958 (proB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3077452..3078633
Genome map
AA seq 393 aa AA seqDB search
MTKARKALENYRRVVIKIGSALLVDRRTGLKKSWLDALCADIAALRAKGVEVLVVSSGAI
ALGRTVLDLPAGALKLEESQAAAAVGQIVLARAWSESLSTHAIVAGQILLTLGDTEERRR
YLNARATIGQLLKLGSVPIINENDTVATTEIRYGDNDRLAARVATMVGADLLVLLSDIDG
LYTAPPHLDPNARFLETVAEITPEIEAMAGGAASELSRGGMRTKIDAGKIATTAGCAMII
ASGKPDHPLAAIEAGARSSWFAPSGSPVTARKTWIAGQLLPAGSLSIDAGAETALRSGKS
LLPAGVRQVTGSFSRGDTIAIIGASGREIARGLAGYDADEARQIAGKKSAEIAAILGYAG
RTAMVHRDDLVMTAPSGARLVEESDEGKGKLHA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggcccgcaaagcgctcgagaattaccgccgggtcgtcatcaagatcggctcg
gcactcctcgtcgaccgcaggaccgggctgaagaagagctggctcgacgcgctctgcgcc
gacattgcggccctcagggccaagggcgtggaagtgctcgtcgtctcctcgggagcgatt
gcgcttggacgcacggtgctcgacctgccggcgggtgcgctgaagctcgaagagagccag
gcggccgccgccgtcggccagatcgtgctggcgcgtgcctggtcggagagcctctcgacc
catgcgatcgtcgccggccagatcctcctgacgctgggcgacaccgaggagcgccggcgc
tacctcaatgcccgcgcgacgatcggtcagcttctgaagctcggctcggtgccgatcatc
aacgagaacgacacggtcgcgaccacagaaatccgctatggcgacaacgaccggctggca
gcgagggtcgcgaccatggtcggcgccgatctcctggtcctgctctcggatatcgacggg
ctctataccgcgccgccgcatctcgatccgaacgcccgtttcctcgaaacggtcgccgaa
atcacgcccgaaatcgaggcgatggcgggcggcgctgcctccgagctttcgcgcggcggc
atgcgcaccaagatcgacgccggcaagatcgcaaccactgccggctgcgcgatgatcatc
gcctccggcaagccggatcatccgctggccgcgatcgaggcgggcgcgcgctcgtcctgg
ttcgcgccatcaggctctccggtgaccgcccgcaagacctggatcgccggacagctcctg
ccggccggttcgctctcgatcgatgccggagcggaaacggcgctgcgttccggcaagagc
ctgctgccggccggcgtccggcaggtgacgggaagcttcagccgcggcgatacgattgcg
ataatcggcgcttccggccgcgagatcgcccgcggtcttgccggctacgatgccgacgag
gcgcgccagatcgccggcaagaagtcggccgagatcgccgccatcctcggctatgccggc
cgcaccgccatggtgcatcgcgacgatctggtcatgacggctccatcgggcgcgcgcctt
gtagaggaaagcgacgagggaaagggcaagctccatgcttga

DBGET integrated database retrieval system