KEGG   Sinorhizobium meliloti Rm41: BN406_03196Help
Entry
BN406_03196       CDS       T02332                                 

Gene name
glcB
Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
smi00620  Pyruvate metabolism
smi00630  Glyoxylate and dicarboxylate metabolism
smi01100  Metabolic pathways
smi01110  Biosynthesis of secondary metabolites
smi01120  Microbial metabolism in diverse environments
smi01200  Carbon metabolism
Module
smi_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN406_03196 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    BN406_03196 (glcB)
Enzymes [BR:smi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BN406_03196 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: CCM69241
Position
3351669..3353840
Genome map
AA seq 723 aa AA seqDB search
MDRVEKYGLQIDAGLHRFLVEEAMPGTGVDADRFFSAFSDLVHDLGPKNRALLVKRDELQ
ARLDGWYREHGAPVDMEAYEAFLREIGYLLPEGPDFYVSTANVDSEIATIAGPQLVVPVM
NARYALNAANARWGSLYDALYGTDAIAETDGAERGKGYNPKRGAKVIAWAREFLDASAPL
ATGRWSDAKSFSVEGATLTVMLADGTKSAPRNSVQFAGYAGDPAAPSEIVLRRNGLHIVI
VLDATTPIGKADAAGISDVVLESAITTIMDCEDSVAAVDAEDKVLVYRNWLGLMKGDLEE
EVTKGGRAFTRRLNPDRAYTAPDGATLTLPGRSLMLVRNVGHLMTNPAVLDRDGEEVPEG
LMDAMVTALIALHDIGRNGRPANSRSGSMYVVKPKMHGPEEVAFACEIFARVESALGLPP
NTMKMGIMDEERRTTVNLKECIRAARERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMK
QAPWISAYENWNVDVGLECGLSGHAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPS
PTAATLHATHYHRVNVAEVQAGLKSRTRAKLADILSVPVAPRPNWTEEEIQRELDNNAQG
ILGYVVRWVDQGVGCSKVPDINNVGLMEDRATLRISAQHMANWLHHGIVSEAQIVETMKR
MAAIVDGQNAGDPNYQPMAGRFEESIAFQAALDLVLKGREQPNGYTEPVLHRRRLELKAK
LGA
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcgttgagaaatatggattgcagatcgatgcggggctccaccgctttctggtc
gaagaggcgatgccaggcaccggcgtcgatgcggatcggttcttttccgccttctcggat
ctcgttcacgatctcggaccgaagaaccgggcccttctcgtcaagcgcgacgagctgcag
gccaggctcgacggctggtatcgcgagcatggtgccccggtcgacatggaagcctatgaa
gccttcctgcgggagatcggctacctcctgcccgaaggtcccgatttttacgtctcgacc
gcaaatgtcgattccgagatcgcgacgatcgccgggccgcagcttgtcgtgccggtgatg
aacgcgcgctatgcgctcaatgccgccaatgcccgctggggatcgctctacgacgccctt
tacggcaccgatgcgatagccgagaccgacggggccgagcgcggcaagggatacaatccg
aagcgcggtgccaaggtcatcgcctgggcgcgagaatttctcgacgcgagcgccccgctg
gcgaccggccgctggagcgatgccaaatcgttctcggtcgagggagcgacgctaaccgta
atgcttgccgacggcacgaagagcgcgccgcgcaattccgttcagttcgccggctatgcc
ggtgaccccgcggcgccgtccgagatcgttctgcgtcggaacggccttcacatcgtcatc
gtcctcgacgcgacgacaccgatcggcaaggccgacgccgccggcatttccgacgtcgtt
ttggaatcggcgatcaccacgatcatggattgcgaggattcggttgcggccgtcgatgcc
gaggacaaggtgctcgtctaccgcaactggctcgggctgatgaaaggcgatctcgaggag
gaggtgaccaagggcggcagggcgttcacccggaggctcaaccccgatagggcctatacg
gctccggacggcgcgacgctgacactgccggggcggtcgctgatgctggtgcgcaatgtg
ggccacctgatgaccaaccccgcggtcctcgaccgggacggcgaagaggtgccggaaggc
cttatggacgccatggtgacggcgctgatcgcactccacgacatcggccggaacggtcgg
ccggcgaattcccgcagcggctccatgtatgtggtcaagccgaaaatgcatgggccggag
gaagtcgccttcgcctgcgagatcttcgcccgcgtagagtcggcgctcgggcttccgccc
aacacgatgaagatgggaatcatggacgaggagcggcggacgaccgtcaacctcaaggaa
tgcatccgcgccgcccgcgaacgggtcgtcttcatcaataccggcttcctcgaccgcacc
ggcgacgaaatccacacctcgatggaagccggcccgatgatccgcaagggcgacatgaag
caggcgccgtggatatcggcctatgagaactggaacgtcgatgtcggtctcgaatgcggg
ctttccggccacgcccagatcggcaagggcatgtgggcgatgccggacctgatggcggcg
atgctggagcagaagatcgcccatccgaaggcgggcgcgaacacggcctgggtaccgtcg
ccgacggccgcgactctgcacgccacccactaccaccgcgtcaacgtcgccgaagtccag
gcgggcctcaagagccgcacccgcgcgaagctagccgatatcctctccgtgccggtcgcc
ccacggccgaactggaccgaggaggaaatccagcgcgaactcgacaacaatgcgcagggc
attctcggttatgtcgtgcgctgggtcgaccagggcgtcggctgctccaaggtgcccgac
atcaacaatgtcggccttatggaggaccgcgcgacgctgcgcatctcggcgcagcatatg
gcgaactggctgcatcacggcatcgtcagcgaagcgcagatcgtcgaaaccatgaagcgc
atggcggcgatcgtcgacgggcagaacgccggcgatccgaactatcagccgatggccggc
cgcttcgaggagtcgatcgcctttcaggcggcactcgatctcgtgctcaagggccgcgag
cagccgaacggctataccgagccggtcctgcaccgccgccggctggagctgaaggcgaag
ctgggggcataa

DBGET integrated database retrieval system