KEGG   Sinorhizobium meliloti Rm41: BN406_03196Help
Entry
BN406_03196       CDS       T02332                                 

Gene name
glcB
Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:smi01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:smi00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:smi00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3351669..3353840
Genome map
AA seq 723 aa AA seqDB search
MDRVEKYGLQIDAGLHRFLVEEAMPGTGVDADRFFSAFSDLVHDLGPKNRALLVKRDELQ
ARLDGWYREHGAPVDMEAYEAFLREIGYLLPEGPDFYVSTANVDSEIATIAGPQLVVPVM
NARYALNAANARWGSLYDALYGTDAIAETDGAERGKGYNPKRGAKVIAWAREFLDASAPL
ATGRWSDAKSFSVEGATLTVMLADGTKSAPRNSVQFAGYAGDPAAPSEIVLRRNGLHIVI
VLDATTPIGKADAAGISDVVLESAITTIMDCEDSVAAVDAEDKVLVYRNWLGLMKGDLEE
EVTKGGRAFTRRLNPDRAYTAPDGATLTLPGRSLMLVRNVGHLMTNPAVLDRDGEEVPEG
LMDAMVTALIALHDIGRNGRPANSRSGSMYVVKPKMHGPEEVAFACEIFARVESALGLPP
NTMKMGIMDEERRTTVNLKECIRAARERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMK
QAPWISAYENWNVDVGLECGLSGHAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPS
PTAATLHATHYHRVNVAEVQAGLKSRTRAKLADILSVPVAPRPNWTEEEIQRELDNNAQG
ILGYVVRWVDQGVGCSKVPDINNVGLMEDRATLRISAQHMANWLHHGIVSEAQIVETMKR
MAAIVDGQNAGDPNYQPMAGRFEESIAFQAALDLVLKGREQPNGYTEPVLHRRRLELKAK
LGA
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcgttgagaaatatggattgcagatcgatgcggggctccaccgctttctggtc
gaagaggcgatgccaggcaccggcgtcgatgcggatcggttcttttccgccttctcggat
ctcgttcacgatctcggaccgaagaaccgggcccttctcgtcaagcgcgacgagctgcag
gccaggctcgacggctggtatcgcgagcatggtgccccggtcgacatggaagcctatgaa
gccttcctgcgggagatcggctacctcctgcccgaaggtcccgatttttacgtctcgacc
gcaaatgtcgattccgagatcgcgacgatcgccgggccgcagcttgtcgtgccggtgatg
aacgcgcgctatgcgctcaatgccgccaatgcccgctggggatcgctctacgacgccctt
tacggcaccgatgcgatagccgagaccgacggggccgagcgcggcaagggatacaatccg
aagcgcggtgccaaggtcatcgcctgggcgcgagaatttctcgacgcgagcgccccgctg
gcgaccggccgctggagcgatgccaaatcgttctcggtcgagggagcgacgctaaccgta
atgcttgccgacggcacgaagagcgcgccgcgcaattccgttcagttcgccggctatgcc
ggtgaccccgcggcgccgtccgagatcgttctgcgtcggaacggccttcacatcgtcatc
gtcctcgacgcgacgacaccgatcggcaaggccgacgccgccggcatttccgacgtcgtt
ttggaatcggcgatcaccacgatcatggattgcgaggattcggttgcggccgtcgatgcc
gaggacaaggtgctcgtctaccgcaactggctcgggctgatgaaaggcgatctcgaggag
gaggtgaccaagggcggcagggcgttcacccggaggctcaaccccgatagggcctatacg
gctccggacggcgcgacgctgacactgccggggcggtcgctgatgctggtgcgcaatgtg
ggccacctgatgaccaaccccgcggtcctcgaccgggacggcgaagaggtgccggaaggc
cttatggacgccatggtgacggcgctgatcgcactccacgacatcggccggaacggtcgg
ccggcgaattcccgcagcggctccatgtatgtggtcaagccgaaaatgcatgggccggag
gaagtcgccttcgcctgcgagatcttcgcccgcgtagagtcggcgctcgggcttccgccc
aacacgatgaagatgggaatcatggacgaggagcggcggacgaccgtcaacctcaaggaa
tgcatccgcgccgcccgcgaacgggtcgtcttcatcaataccggcttcctcgaccgcacc
ggcgacgaaatccacacctcgatggaagccggcccgatgatccgcaagggcgacatgaag
caggcgccgtggatatcggcctatgagaactggaacgtcgatgtcggtctcgaatgcggg
ctttccggccacgcccagatcggcaagggcatgtgggcgatgccggacctgatggcggcg
atgctggagcagaagatcgcccatccgaaggcgggcgcgaacacggcctgggtaccgtcg
ccgacggccgcgactctgcacgccacccactaccaccgcgtcaacgtcgccgaagtccag
gcgggcctcaagagccgcacccgcgcgaagctagccgatatcctctccgtgccggtcgcc
ccacggccgaactggaccgaggaggaaatccagcgcgaactcgacaacaatgcgcagggc
attctcggttatgtcgtgcgctgggtcgaccagggcgtcggctgctccaaggtgcccgac
atcaacaatgtcggccttatggaggaccgcgcgacgctgcgcatctcggcgcagcatatg
gcgaactggctgcatcacggcatcgtcagcgaagcgcagatcgtcgaaaccatgaagcgc
atggcggcgatcgtcgacgggcagaacgccggcgatccgaactatcagccgatggccggc
cgcttcgaggagtcgatcgcctttcaggcggcactcgatctcgtgctcaagggccgcgag
cagccgaacggctataccgagccggtcctgcaccgccgccggctggagctgaaggcgaag
ctgggggcataa

DBGET integrated database retrieval system