KEGG   Sinorhizobium meliloti Rm41: BN406_03292Help
Entry
BN406_03292       CDS       T02332                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN406_03292 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN406_03292 (glk)
   00052 Galactose metabolism
    BN406_03292 (glk)
   00500 Starch and sucrose metabolism
    BN406_03292 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    BN406_03292 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BN406_03292 (glk)
   00524 Butirosin and neomycin biosynthesis
    BN406_03292 (glk)
Enzymes [BR:smi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BN406_03292 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3465311..3466330
Genome map
AA seq 339 aa AA seqDB search
MPNASEHSFPFPILIGDIGGTNARFALLTDAYGEPKQLAPIRTGDFATIEEAMQKGILDK
TSVQPRSAILAVAGPIKGDEIPLTNAGWVIRPKDMLASLGLEDVLVINDFEAQALAIAAP
ADQDVVQIGGGAVRPFHSRVVLGPGTGLGVAGLVYAQHTWIPVPGEGGHVDIGPRTERDF
RIWPFLEPIEGRMAGEQILCGRGIMNLYRAVCAANGEEAVLADQAAVTTSALSGADAAAV
ETVSLFATYLGRVAGDMALIFMARGGVFLAGGISQKILPALTKPEFRAAFEDKAPHSALM
RTIPTFAVIHPMAALSGLAAFARTPRDFGVAMEGRRWRR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcccaatgcgagtgaacacagctttccctttccgatcctgatcggcgacatcggcggc
accaatgcccgcttcgcactgctcaccgacgcctacggcgaaccgaagcagttggccccg
atcagaacgggcgatttcgccacgatcgaggaggcgatgcagaaaggcatcctcgacaag
acctccgtccagccgcgctcggcgatcctcgccgtggccgggccgatcaagggcgacgag
ataccgctgacgaatgccggctgggtgattcgtccgaaggacatgctggcgagcctcggg
ctggaggatgtgctggtcatcaacgacttcgaggcccaggcgctcgccatcgccgcgccg
gccgatcaggatgtcgttcagatcggcggcggagccgtccggcccttccattcgcgcgtc
gtgctcggcccgggaaccggtctgggcgtcgccggactggtctatgcgcagcatacctgg
atacccgtgcccggcgagggcggtcatgtcgatataggtccccggacggagcgcgacttc
cggatctggcccttcctcgaaccgatcgagggacgcatggccggcgagcagatcctgtgc
ggccgcggcatcatgaatctctatcgcgctgtctgcgccgccaatggcgaggaagcggtt
cttgcggatcaggcggcagtgacgacgagcgcgctctccggcgccgatgcggcggcggtc
gaaaccgtgtcgctctttgcgacctatctcgggcgcgttgccggcgacatggcgctgatc
ttcatggcgcgcggcggcgtattccttgccggcggcatttcgcagaagatactgccggca
ctgacgaagcccgaatttcgcgcggccttcgaggacaaggcgcctcattcggcattgatg
cggacgattccgaccttcgccgtcattcaccccatggcggcgctctccggcctcgcggcc
tttgcccgcacgccgagggacttcggtgttgcaatggagggacgccgttggagaaggtga

DBGET integrated database retrieval system