KEGG   Sinorhizobium meliloti Rm41: BN406_03634Help
Entry
BN406_03634       CDS       T02332                                 

Gene name
hisD2
Definition
Histidinol dehydrogenase 2 (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BN406_03634 (hisD2)
  Amino acid metabolism
   00340 Histidine metabolism
    BN406_03634 (hisD2)
Enzymes [BR:smi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BN406_03634 (hisD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSYMA:139349..140719
Genome map
AA seq 456 aa AA seqDB search
MTLRPQLARYKDKTMTSVSFYEYSKLNAEEKAALLRRSETDISGFIEKVAPILEAVRTEG
DKALARFGRELDKADVTEANLKVTAAEFDAAFKLVDASVLESVQFGIDNIRKFHEEQKPE
AMWLKEIRPGAFAGDRFTPIQSVALYVPRGKGSFPSVTMMTSVPAVVAGVPNLAIVTPPA
PDGSVDAATLVAARLAGVETVYKAGGAQAVAAVAYGTETVKPALKIVGPGSPWVVAAKRS
LSGVIDTGLPAGPSEVMILADDTVHGGLAALDLLIEAEHGPDSSAYLVTHSRRVAEEALA
ALPEHWAKMTEQRVAFSKAVLTGKTGGIVLTSSIEESYAFVNAYAPEHLELLSEQPFIHL
GHITEAAEILMGTHTPVSIANFSLGPNAVLPTSRWARTFGPLSVTDFVKRSSIGYVTAPA
YPEFARHSHNLAIYEGFSSHALAVSPVRDRYLKKGA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaccctccggccccaactggccagatacaaggacaagacgatgacatcagtgtctttc
tacgaatattcgaagctgaacgccgaagagaaggccgccttgctgcgccgttcggaaacc
gacatatcgggcttcatcgaaaaggtcgcgccgatcctcgaagcggtccgcaccgagggc
gacaaggcactggcacgcttcggccgcgaactcgacaaggccgatgtaacggaagccaat
ctcaaggttacggcggcagagttcgatgcggccttcaagctggttgatgcaagtgtcctc
gagtccgttcaattcggcatcgacaacatccgcaaattccatgaggagcagaagccagaa
gccatgtggctgaaggagatccgccccggcgcttttgccggagaccgcttcacgcccatt
cagtcggtcgcgctctacgtcccacggggcaagggctccttcccgtcggtgactatgatg
acatcggtcccggccgtggttgcaggcgtcccgaacctggccattgtcacgccgccggcg
ccggacggttcggtcgatgccgcgacgctggttgctgcacgtctcgccggcgttgaaacc
gtctacaaggcgggcggcgcgcaggccgttgctgctgtcgcctatggcaccgaaacggtc
aagccggcgctgaagatcgtcggtcccggcagcccttgggtggtcgccgccaagcgctcg
ctctccggcgtcatcgataccgggcttcccgctggtccgtccgaggtgatgatcctcgcc
gacgacacggtccatggtggccttgccgcgctcgacctgctgatcgaggccgaacatggc
ccggattcttccgcttacctcgttacccacagccgccgcgtcgccgaggaggcgctcgca
gcccttccggaacattgggcgaaaatgaccgagcagcgcgtcgccttttcaaaggccgtg
ctgacggggaagacgggcggcatcgttctgacctcttcgattgaggaaagctacgccttc
gtcaacgcctatgcgcccgagcatctggaactcctgtcggagcagcccttcatacatctc
ggccacatcacggaagcggccgaaatcctgatgggcacccatactccggtcagcatcgcc
aatttctcgctcgggcccaacgccgtattgccaaccagccgctgggcccgcaccttcggc
ccgctgtcggtcaccgatttcgtcaagcgcagttcgatcggctatgtcacggcaccggcc
tatccggaattcgccaggcattcccacaatctggcgatctacgagggcttctcctcgcat
gcgcttgccgtatcgcccgtgcgcgatcgttatctgaagaagggcgcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system