KEGG   Sinorhizobium meliloti Rm41: BN406_04098Help
Entry
BN406_04098       CDS       T02332                                 

Gene name
adhA1
Definition
Alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BN406_04098 (adhA1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN406_04098 (adhA1)
  Lipid metabolism
   00071 Fatty acid degradation
    BN406_04098 (adhA1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BN406_04098 (adhA1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BN406_04098 (adhA1)
   00626 Naphthalene degradation
    BN406_04098 (adhA1)
Enzymes [BR:smi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BN406_04098 (adhA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSYMA:587964..588992
Genome map
AA seq 342 aa AA seqDB search
MAQTMKAAVVRQFRAPLTIEEMEVPTPGAGQVLVKYEATGVCHTDLHAANGDWPVKPAPP
FIPGHEGVGFVSAVGAGVRRVKEGDKVGVPWLHTACGYCTYCRTGWETLCASQSNTGYSV
NGTFAEFGLADPEFVGKIPDGLEFGAAAPVLCAGVTVYKGLKETEVRPGEWVAISGVGGL
GHMAVQYAKAMGMHVVAADIFEDKLALAKQLGADIAINGKSEDAIEQVQKATSGGVHGVL
VTAVSPAAMEQAFGFLRSKGTMVLVGLPPGMMSLPVFETVLKRITVRGSIVGTRQDLEES
LVFAAEGKVKPYFSWESLENINDIFHRMEAGKIDGRIVVRLQ
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcacagacaatgaaggcggctgtcgtacgccagttccgcgctccgctgaccatagag
gagatggaagtcccaacgcctggcgcggggcaggtcctggtaaaatatgaagcgacgggc
gtgtgccataccgatctgcatgcggcaaacggcgattggcccgttaagccggccccgccc
tttattccagggcatgagggtgttggcttcgtctcagccgtgggcgccggcgtgaggaga
gtgaaagaaggtgacaaggttggggtgccatggctccacaccgcttgcggttactgtacc
tattgccggaccggttgggaaacgctgtgcgcttcgcaatcgaacaccgggtactcagtg
aacggcaccttcgcggagttcggactggcagatcccgagttcgtcggaaagattcctgat
gggttggaattcggagccgccgcgcccgttctctgcgcgggagtgaccgtctacaagggg
ctgaaggaaacggaagtccgtcccggtgaatgggtggccatctcgggcgtcgggggtctc
ggccacatggcggtgcaatatgccaaggcaatgggaatgcacgtagtggccgccgacata
ttcgaagacaagctggcgctggctaagcaacttggcgccgacatcgcaataaacggcaag
tcagaagatgcaatcgagcaggtacagaaggccacgagcggcggcgttcacggagtgctc
gtgaccgctgtctctcccgccgccatggaacaggcctttggtttcctgcggtcgaaaggt
acgatggtcttggtcggccttccccccggaatgatgtccttgccggttttcgagaccgtc
ctgaaacgcataaccgtgcgtggatcaatcgtgggcacccgtcaagaccttgaggaatcg
ctcgtgttcgcggcggaaggcaaggtaaagccttatttctcgtgggagagcctcgagaac
atcaacgacatctttcatcgcatggaagcgggcaagatcgacggtcgcatagtcgtgcga
ttgcaatag

DBGET integrated database retrieval system