KEGG   Sinorhizobium meliloti Rm41: BN406_04546Help
Entry
BN406_04546       CDS       T02332                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BN406_04546
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BN406_04546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSYMA:complement(1027678..1028046)
Genome map
AA seq 122 aa AA seqDB search
MNKVVIAALVSLAVSGHATPALSQEAAPGQKLFQQRCGACHQLETPRNGVGPHLLGVVGR
TAGSVDGFRYSAALKGSGIAWTAETLETFLSNPAAMVRGTRMAQRFNNADERRAIIAFLG
AQ
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaaggtcgtcattgctgcgctcgtttctcttgctgtttcaggccacgccacgccg
gctctgtctcaggaggctgcaccaggtcagaagctgtttcagcaacgctgcggtgcgtgc
catcagctcgagacacctcgaaacggcgtcggaccgcatctgctgggtgtcgtcggccga
acggccggcagcgttgacggcttcaggtattccgcggcgcttaaaggttccggtatcgca
tggaccgccgaaacgctggaaaccttcctgagcaatcccgccgcgatggttcgcggaacg
cgcatggcccagcgtttcaacaacgccgacgagcgtcgagcgatcatcgcgttccttggg
gcgcaatag

DBGET integrated database retrieval system