KEGG   Sinorhizobium meliloti Rm41: BN406_04546Help
Entry
BN406_04546       CDS       T02332                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
smi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:smi00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BN406_04546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-ProteinID: CCM70828
Position
pSYMA:complement(1027678..1028046)
Genome map
AA seq 122 aa AA seqDB search
MNKVVIAALVSLAVSGHATPALSQEAAPGQKLFQQRCGACHQLETPRNGVGPHLLGVVGR
TAGSVDGFRYSAALKGSGIAWTAETLETFLSNPAAMVRGTRMAQRFNNADERRAIIAFLG
AQ
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaaggtcgtcattgctgcgctcgtttctcttgctgtttcaggccacgccacgccg
gctctgtctcaggaggctgcaccaggtcagaagctgtttcagcaacgctgcggtgcgtgc
catcagctcgagacacctcgaaacggcgtcggaccgcatctgctgggtgtcgtcggccga
acggccggcagcgttgacggcttcaggtattccgcggcgcttaaaggttccggtatcgca
tggaccgccgaaacgctggaaaccttcctgagcaatcccgccgcgatggttcgcggaacg
cgcatggcccagcgtttcaacaacgccgacgagcgtcgagcgatcatcgcgttccttggg
gcgcaatag

DBGET integrated database retrieval system