KEGG   Sinorhizobium meliloti Rm41: BN406_04546Help
Entry
BN406_04546       CDS       T02332                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:smi00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:smi02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSYMA:complement(1027678..1028046)
Genome map
AA seq 122 aa AA seqDB search
MNKVVIAALVSLAVSGHATPALSQEAAPGQKLFQQRCGACHQLETPRNGVGPHLLGVVGR
TAGSVDGFRYSAALKGSGIAWTAETLETFLSNPAAMVRGTRMAQRFNNADERRAIIAFLG
AQ
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaaggtcgtcattgctgcgctcgtttctcttgctgtttcaggccacgccacgccg
gctctgtctcaggaggctgcaccaggtcagaagctgtttcagcaacgctgcggtgcgtgc
catcagctcgagacacctcgaaacggcgtcggaccgcatctgctgggtgtcgtcggccga
acggccggcagcgttgacggcttcaggtattccgcggcgcttaaaggttccggtatcgca
tggaccgccgaaacgctggaaaccttcctgagcaatcccgccgcgatggttcgcggaacg
cgcatggcccagcgtttcaacaacgccgacgagcgtcgagcgatcatcgcgttccttggg
gcgcaatag

DBGET integrated database retrieval system