KEGG   Sinorhizobium meliloti Rm41: BN406_04552Help
Entry
BN406_04552       CDS       T02332                                 

Gene name
gst12
Definition
Gst12 glutathione-S-transferase (EC:2.5.1.18)
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:smi00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSYMA:complement(1034105..1034752)
Genome map
AA seq 215 aa AA seqDB search
MITLYDYELSGNCYKLRLLMSMLGIEYKTVPVDFYPGREHKSDWFLKLNPLGQLPVIEDD
GLVLRDAQAILVYIGSKYDPSGTWYPRDNPALLGEISQWLAFADGITGTASAARLHDGLF
YELDVEAARAGAHRLFRILDEHLWFGEQEGRDWICSAPHPTVADIACFPYIMLSEEGGIP
RQDYPAIRRWCDRLKRIKGFTVMSGIFPAGPARAA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccctctacgattacgaactctcgggcaactgctacaagctcagacttctgatg
agcatgctcggcatcgagtacaagacggtaccggtcgatttctatcccggccgcgaacac
aagtcggattggttcctgaagctcaatccgcttggacaactcccggtgatcgaggatgac
ggactggtgctgcgcgacgcgcaggcgatcctcgtctacatcggctccaaatatgatcct
tccggcacctggtatccgcgtgacaacccggcgctgctcggcgagatcagtcagtggctc
gcctttgcggacgggatcacgggcacggcttcggccgcgcgtctccatgacggcctgttc
tacgaactggacgtcgaggcggctcgggccggtgcgcacaggctgtttcgcatcctcgac
gagcatctctggttcggcgagcaggaagggcgcgactggatctgctcggccccacacccg
accgtcgctgacatcgcctgtttcccctacatcatgctgtcggaagaggggggcattccc
cggcaggactatccggcaatccgtcgttggtgcgatcgcctcaagcggatcaaaggcttc
acggtcatgtcggggatctttcctgccggcccggcgcgtgccgcttga

DBGET integrated database retrieval system