KEGG   Sinorhizobium meliloti Rm41: BN406_04579Help
Entry
BN406_04579       CDS       T02332                                 

Gene name
pcm1
Definition
Protein-L-isoaspartate O-methyltransferase 1 (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
smi  Sinorhizobium meliloti Rm41
Brite
Enzymes [BR:smi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BN406_04579 (pcm1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSYMA:1061595..1062266
Genome map
AA seq 223 aa AA seqDB search
MKPMNEEHLAVLRRHMVEVVAIYADLASEELGKAALDERVMAAMLRVPRHLFVPAQAAPF
AYQDMPLPIGFDKTVSQPFMVALMTDLLAPKPHEAVLEIGTGLGYQTAILAQLAGKIWSV
EIIEEFASHAEALLHGLGMSNVGIRIGDGSRGWPEHAPFDKILVTAAAEEPPPALLEQLK
PMGRLVLPVGSEEQVLTVIDKDSEGQFLARQLIPVRFSKLEAV
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaatgaacgaagagcacctcgccgttctgcgcaggcacatggtcgaggtggtc
gcaatctatgccgaccttgcaagtgaagaactcggcaaggcggcgctcgatgaacgggta
atggcagcgatgctgcgggtaccgcggcatctgttcgtgcccgcccaggctgcgcccttt
gcctaccaggacatgccgcttccgatcggcttcgataaaaccgtgtcgcagcccttcatg
gtcgcactcatgaccgatctccttgctcccaaaccgcatgaggccgtgcttgagatcggc
accggcctgggctatcaaaccgcaatcctcgctcaactcgccgggaagatttggagcgtc
gagatcattgaggaattcgcaagccatgccgaggctctcctgcacggcctcggcatgtct
aatgtcggcattcgtatcggcgacggttcacgcggctggcctgagcacgctccattcgac
aagatcctggtcacggcggcggctgaggagccgcctccggctttgctcgagcagctcaag
ccaatgggccgccttgttcttcctgtgggttcggaagaacaggtgctgactgtcatcgac
aaggattcggaagggcaattcctggcgcggcaactcatcccggttcggttcagcaagctc
gaggcggtctaa

DBGET integrated database retrieval system