KEGG   Sinorhizobium meliloti Rm41: BN406_04674Help
Entry
BN406_04674       CDS       T02332                                 

Definition
Arginase/agmatinase/formiminoglutamase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BN406_04674
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BN406_04674
Enzymes [BR:smi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BN406_04674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSYMA:1166394..1167287
Genome map
AA seq 297 aa AA seqDB search
MPTLPYAILEAPSTLGLATHGVERLPDQLLHLGLAERIHARHAERLAVPPKEPTPDPETG
ILNARAIAAWSPKLADAVEAVLTAGEFPVVLGGDCTIVLGSMLAFRRRGRYGLLFIDGNA
DFFQPEAEPNGEGASMDLALVTGYGPSHLTDIEGRGPLVRPEDAVAFAYRDHKDQEEYGS
QPLPNELKAIDLPAVRAVGIEAAAREAVDHLTREELDGFFIHLDADCLDDAIMPAVDFRM
PDGLSWDELGTALRVALASGKAVGIEITIYNPRLDESGSAGRDLADVLATALGTAAS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgccgacccttccttatgcaattctcgaagccccttccacgttgggactggcgacccac
ggagtggagcgcctgcccgaccaactcctgcatctcggtcttgcggagcgcatccatgcg
cgccacgccgagcggctggcggtgcctccgaaggagcctacgccagatcccgagaccggc
atcctgaatgcgagggcaattgcggcttggtcgcccaagctcgccgacgcggtggaagcg
gtgcttaccgcgggcgaatttccggtggtactgggcggcgattgcacgatcgtgctgggc
tcgatgctcgcgtttcgccgacgcggccgctacggcctgctcttcatcgacggcaacgcc
gatttcttccagcccgaggcggaacctaatggtgagggcgcctccatggaccttgccctc
gttaccggctacggcccgtcacatctgaccgacattgaaggtcgcggtcctctggtccgt
cccgaagacgctgtcgcgttcgcatatcgcgatcataaggatcaggaggagtacggaagc
cagccgctccctaacgagctcaaggcgattgatcttcccgccgtgcgcgcagtgggcatt
gaggccgccgcgcgcgaagcggttgaccacctgacgcgagaggaactggacggcttcttc
atccatctcgacgccgattgcctcgacgacgccatcatgccggctgtcgatttccgcatg
ccggacgggttgtcgtgggacgagctagggaccgcgcttcgggttgccttggcgagtggc
aaggcagtcggcatcgagatcaccatctacaatccgcgccttgatgagtccggcagcgcc
gggcgcgacctggccgacgtactggccacagccctcggaacagcagcgtcctga

DBGET integrated database retrieval system