KEGG   Sinorhizobium meliloti Rm41: BN406_05000Help
Entry
BN406_05000       CDS       T02332                                 

Definition
hypothetical protein
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BN406_05000
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN406_05000
Enzymes [BR:smi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     BN406_05000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSYMA:1475535..1476974
Genome map
AA seq 479 aa AA seqDB search
MNTTSFFSDMLQSIAERGRRFLSLGPARNGDVNPVGTMEALCDTLLSSRGEASGMALAKN
ILDRWQGFDQDKRRDFMLALLSRFGPDIERLERAIDAYRADPTPKALLEMSMAAEPRRQE
LIRRLNLAPNGIATLVRMRADLLELKAQNPDLEAVDTDFAHLFGSWFNRGFLVLRPISWS
TPADILEKIIRYEAVHHIGGWDELRRRLAPEDRRCFAFFHPQLVDDPLIFVEVALTREMP
PNIADLLKEDRAPIRATDATTAVFYSISNCQEGLRGISFGNFLIKQVVEDLRRDLPRLDT
FVTLSPVPGFADWLSRERQAETSNALSAADRSRLAALDEPDWADQPEIAAAIQPSLTAAA
AWYFLRARNRNGKTVDPVARFHLGNGARLERINFLGDRSERAMRQAHGLMVNYLYKLDDI
ETNHEAFATRGEVVAAPAIRRLIPADRSSRSLVPGPNVFPPGVRSADAPGRKGDKEFTS
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgacgtcttttttcagcgacatgctgcagagcattgccgagcgcggccggcga
ttcctgtcgctcggtccggcccgaaacggcgatgtcaatccggtcggcaccatggaagcg
ctctgcgacacgctgctgtcgagccggggcgaggcgtcgggcatggcgctggccaagaac
attctggatcgctggcaaggcttcgatcaggacaagcggcgcgatttcatgttggcgctg
ctctctcgtttcggccctgatatcgaacggctggagcgggcgatcgacgcctatcgcgcc
gatccgacgccgaaggcgctgctcgagatgagcatggcggcagaaccgcgccgccaggaa
ttgatccgcaggctcaaccttgcgccgaacggcatcgcgaccctcgtccgcatgcgggcg
gacctcctcgaacttaaagcccaaaaccccgatctggaggcggtcgatacggacttcgcg
catctcttcggatcctggttcaatcggggcttcctcgtgctgcggccgatcagctggtcg
acgccggccgacattctggaaaagatcattcgttacgaggccgtccatcatatcggcggc
tgggacgagttgcgccggcggcttgcgccggaggaccggcgctgcttcgccttctttcat
ccgcagctggtcgacgacccgctgatcttcgttgaagtggcgctgacacgcgaaatgcct
cccaacatcgcggacctgctgaaggaggatcgtgctccgatccgcgctactgacgcgacg
acagccgtcttctattccatttcgaactgtcaggaaggcctcaggggcatctccttcggc
aacttcctgatcaaacaggtggtggaggatctgcggcgcgacctccctcgcctcgacacc
ttcgtgacgctgtcgccggtgccgggctttgccgattggttgtcgcgcgaacgccaggcg
gaaacgtccaacgccctgtcggccgccgatcgcagcaggctcgcggcgctcgacgagcct
gattgggccgatcagccggagatcgcggcagccatccagccaagccttaccgctgcggcc
gcctggtatttcctcagggctcgcaaccgcaacggcaagacagttgatcccgttgcccgg
ttccatctcggcaatggcgcgcggctggaacgcatcaatttcctaggcgaccggtccgaa
cgggccatgcgccaggcccacgggctgatggtcaactatctttacaagctcgacgacatc
gagacgaaccacgaggcatttgcaacccgtggcgaggtcgtcgccgcacccgcgatccgc
cggctgatcccggccgacagaagttcacgtagcctcgttccgggtccgaacgtgtttccc
ccgggcgtccgatcagctgacgcaccaggaaggaagggtgacaaggagttcacttcatga

DBGET integrated database retrieval system