KEGG   Sinorhizobium meliloti Rm41: BN406_05114Help
Entry
BN406_05114       CDS       T02332                                 

Definition
dihydrolipoyllysine-residue succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN406_05114
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN406_05114
  Amino acid metabolism
   00310 Lysine degradation
    BN406_05114
Enzymes [BR:smi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BN406_05114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSYMB:31688..32824
Genome map
AA seq 378 aa AA seqDB search
MGGLIDIQAPLEQEGTKAVVRNWLRKIGDPVKSGDPLVELETDKVTQEVSAPADGVLAEI
LMRNGDDATPGAVLGRIGSEAAGAGHAPHYSPAVRHAAEEYGLDPATVTGTGRGGRVTRA
DMDRAFTARQEGPASVAAEAGDRGAAPKSRRIPHSGMRAAIAEHMLNSVTTAPHVTAVFE
ADFSAVMRHRDEHGKRLAADGTKLSYTAYVVSACVAAMRAVPEVNSRWHEDALETFDDIN
IGVGISLGDKGLVVPVIHRAQDLSLAEIAARLQDLTTRARSSALSRADVTGGTFTISNHG
ASGSLLAAPIIINQPQSAILGVGKLDKRVIVREVDGADTIQIRPMAYVSLTIDHRALDGH
QTNAWLTHFVRVIETWPK
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcctcatcgacatccaggctccgctggagcaggaggggaccaaagcggtcgtc
cgcaattggctcaggaagatcggcgatccggtcaaatcgggcgatcccctggtcgagctc
gagaccgacaaggtgacccaggaggtgtcggcgcccgccgacggggtgctcgcggaaatc
ctgatgcggaatggcgacgatgccacgcccggcgccgttctcggccggatcggcagcgag
gctgccggggcgggacacgcgccgcactactcgccggccgtacggcatgccgcggaagaa
tatggcctcgatccggccaccgtcaccggcaccggccgcggtggccgcgtcacgcgcgcc
gacatggacagggcgtttaccgcccggcaggaaggccctgcttcggtcgcggccgaggct
ggcgacagaggagccgcacccaagtcgcgcaggataccgcatagcggcatgcgcgccgcg
atcgccgaacatatgctcaactccgtcacgacggcgccgcatgtgacggccgtgttcgag
gccgatttctcggcggtgatgcgccatcgggacgagcatgggaagaggcttgccgcggac
ggcaccaagctctcctatacggcctatgtggtttcagcctgcgtggcggcgatgcgcgcg
gtccccgaggtcaacagccgctggcacgaggacgcgctcgaaacattcgacgacatcaat
atcggcgtaggtatttccctcggggacaagggcctggtcgtgccggtgatccatcgggcg
caggatttgtcgcttgccgagattgcggcccggctgcaggacctgacgacgcgtgcgcgc
tcgagcgcgctctcccgcgcggacgtgacgggcggcaccttcaccatttccaatcatgga
gcctccggatcgctactcgcggcgccgatcatcatcaaccagccgcaatcggcgatcctc
ggcgtgggcaagctcgacaagcgggtgatcgtccgcgaggtggacggcgccgacacgatc
cagatccgtccgatggcctatgtgtcgctgacgatcgaccatcgtgcgctggacggccac
cagacgaatgcgtggctgacgcatttcgtccgcgtgatcgagacctggccgaagtaa

DBGET integrated database retrieval system