KEGG   Sinorhizobium meliloti Rm41: BN406_05128Help
Entry
BN406_05128       CDS       T02332                                 

Gene name
gstA
Definition
Protein gstA
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:smi00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSYMB:complement(50130..50741)
Genome map
AA seq 203 aa AA seqDB search
MKLYHHPLSGHAHRARLFLSLLGIEHELVVVDFARREHKQADFLKLNSFGQVPVLEDAGT
IISDSNAILVYLAKKTGRPDWLPEDAAGAAAVQRWLSVAAGQIAHGPAQARLINVFKAPY
RPEEVIPRSHAILALIEQELEGRGWIAADRPTIADVALYSYVARAPEGDVDLQPYPEIRA
WLARIEALPGFVEFEKTPVGLAA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctatcaccatcccctctccggccacgcgcaccgcgcccgcctgttcctctcg
ctgctcggtatcgagcatgagctggtggtcgtcgatttcgccaggagagagcacaagcaa
gcggatttcctgaagctcaattccttcggtcaggttccggtgctcgaagacgccggcacg
atcatctcggattccaacgccattctcgtctatctggccaagaagaccggccgcccggac
tggctgccggaagacgccgccggggcggctgccgttcagcgctggctttcggtggctgcc
ggccagatcgcccacggtccggcccaggcgcggctcatcaacgtgttcaaggcgccctac
cgaccggaagaggtgatcccccgttcgcatgcgatcctggcgctgatcgagcaggagctg
gaaggcagaggctggattgccgcagaccggccgacgatcgccgatgtcgcgctctacagc
tacgtagcgcgcgcccccgaaggcgacgtcgatctccagccctatccggagatccgcgcc
tggctcgcccgcatcgaggcattgccgggattcgtcgagttcgaaaagacgccggtgggg
ctggcggcttag

DBGET integrated database retrieval system