KEGG   Sinorhizobium meliloti Rm41: BN406_05140Help
Entry
BN406_05140       CDS       T02332                                 

Gene name
melA1
Definition
(RefSeq) alpha-galactosidase (EC:3.2.1.22)
  KO
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BN406_05140 (melA1)
  Lipid metabolism
   00561 Glycerolipid metabolism
    BN406_05140 (melA1)
   00600 Sphingolipid metabolism
    BN406_05140 (melA1)
Enzymes [BR:smi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BN406_05140 (melA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
pSYMB:62164..63636
Genome map
AA seq 490 aa AA seqDB search
MASFKIAIIGAGSIGFTKKLFTDILSVPELRDVEFALTDLSEHNLAMIKSILDRIVEANE
LPTRVTATTDRRKALEGARYIISCVRVGGLEAYADDIRIPLKYGVDQCVGDTICAGGILY
GQRNIPVILDFCKDIREVAEPGAKFLNYANPMAMNTWAAIEYGKVDTVGLCHGVQHGAEQ
IAEILGARDGELDYICSGINHQTWFVDVRLNGRKVGKDELVAAFEAHPVFSKQEKLRIDV
LKRFGVYSTESNGHLSEYLPWYRKRPDEISRWIDMSDWIHGETGGYLRYSTETRNWFETE
YPRFLEEAGRPLETIRRSNEHASRILEALETGRVYRGHFNVKNNGVITNLPADAIIESPG
FVDRFGINMVAGITLPEACAATCISSVNVQRMSVHAAITGDIDLLKLAVLHDPLVGAICT
PEEVWQMVDEMVVAQAKWLPQYAHAIDAAKERLARATVATREWKGAARREVRSIEEIRAE
KEAAKLRAAG
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggccagcttcaagatcgccatcatcggcgccggcagcatcggcttcaccaagaagctc
ttcaccgacattctttccgtgccggagctccgggacgtcgagttcgcgttgacggatctg
agcgagcacaacctcgccatgatcaagtccatcctcgaccggatcgtcgaggcgaacgaa
ctgcccacgcgggtgacggcgacgaccgaccgccgcaaggcgctggaaggcgcacgctac
atcatcagctgtgtgcgcgtcggcggcctcgaggcctatgccgacgatattcgcattcca
ttgaagtacggcgtcgaccaatgcgtcggcgacacgatctgcgccggcggcatcctctac
ggccagcgaaacattccggtgatcctggatttttgcaaggacattcgcgaggtggcggag
cccggcgccaagttcctcaactatgccaacccgatggcgatgaacacctgggcggcgatc
gaatacggcaaggtcgacacggtcggtctctgccacggcgtccagcacggggccgagcag
atcgccgaaattctcggcgccagggacggggagctcgactacatctgctccggcatcaac
caccagacatggttcgtcgatgtccgtctcaacggccgcaaggtcggcaaggacgaactc
gtcgccgccttcgaggcgcatccggtcttttccaagcaggagaagctccggatcgacgta
ttgaagcgcttcggcgtctattcgaccgaaagcaacggacatctgtccgaatacctgccc
tggtaccgcaagcgtccggacgagatctccagatggatcgacatgtccgactggatccac
ggggagaccggcgggtatctccgctattcgaccgagacccgcaactggttcgagaccgaa
tatccgcgcttcctcgaagaggcgggccggccgctggaaacgatcaggcgctcgaacgaa
catgcgagccgcatcctcgaagcgctcgagacgggtcgggtctatcgcggccacttcaac
gtcaagaacaacggcgtgatcaccaacctgccggcagatgcgatcatcgaatcccccggc
ttcgtcgatcggttcggcatcaacatggtggcaggcatcacgttgccggaggcctgtgcg
gccacctgcatctcgtcggtcaacgtccagcgcatgtccgttcatgcggcgatcaccggc
gacatcgatctcctgaagctcgcggtgctgcacgacccgctggtcggcgccatctgcacg
ccggaggaagtctggcagatggtcgacgaaatggtggtcgcgcaggccaaatggctgccg
caatatgcccatgcgatcgacgcggccaaggaaaggctcgcccgcgccacggtcgccacc
cgggagtggaagggcgccgcgcgtcgcgaggtgcgctcgatcgaggagatccgagcggag
aaggaagcggcgaagctgcgcgctgcggggtag

DBGET integrated database retrieval system